DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pasi2 and pasi1

DIOPT Version :9

Sequence 1:NP_649883.1 Gene:pasi2 / 41113 FlyBaseID:FBgn0037680 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001247158.1 Gene:pasi1 / 42139 FlyBaseID:FBgn0038545 Length:169 Species:Drosophila melanogaster


Alignment Length:147 Identity:35/147 - (23%)
Similarity:60/147 - (40%) Gaps:34/147 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 YCYAMAAPGSTHYGYYIISYE----FVYVGNKHVRNMLIVFALFSLIMALINFVTSVLLCVALRK 146
            |..|::|...|...|.:...|    :..:....:|:.:.|...|.:|..|:..::|.|:...::.
  Fly    27 YTAALSAVMITLISYMLAGGESAQLYSPLFETDIRSSMPVAGGFFIIYFLLIILSSYLVYYGIKI 91

  Fly   147 EYERKVMPWL------------WS-FAIFTVWRALALIFFAIVNDLYFAYNVIMVLLWTIFCVLS 198
            .....::|||            || :.|...:..|...|.|::|.::.|||              
  Fly    92 STRGWLLPWLGLIGLAILFQFSWSLWLIGGYYIYLEQTFSALLNFVWVAYN-------------- 142

  Fly   199 IYGWAVV---YSLFLEL 212
            ||.|.||   |.:|||:
  Fly   143 IYCWLVVFSQYQIFLEI 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pasi2NP_649883.1 None
pasi1NP_001247158.1 DUF4728 76..156 CDD:292485 22/93 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR36694
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.