DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pasi2 and CG13288

DIOPT Version :9

Sequence 1:NP_649883.1 Gene:pasi2 / 41113 FlyBaseID:FBgn0037680 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001261455.1 Gene:CG13288 / 38665 FlyBaseID:FBgn0035648 Length:273 Species:Drosophila melanogaster


Alignment Length:170 Identity:32/170 - (18%)
Similarity:70/170 - (41%) Gaps:49/170 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 DIQKGAMLVGLFAIFLSLFTIATSIFDIYCYAMAAPGSTHYGYYIISYEFVYVGNK--------- 113
            |::.|:....::.  |..|..:|.:|               .:|:|..:...:||:         
  Fly    12 DVRSGSFACAIYT--LVYFGFSTLMF---------------LFYLIEEQDFLLGNRAQPLGESLL 59

  Fly   114 ---HVRNMLIVFALFSLIMALINFVTSVLLCVALRKEYERKVMPWLWSFAI--------FTVWRA 167
               .|..:.::|.:..|..:::..::||||.:.|::.....::||: ||.:        ..|..|
  Fly    60 EKGDVTVVTVIFNILLLFCSILMVLSSVLLILGLQQNKRHLLIPWI-SFMLGDLLIEVCHLVHLA 123

  Fly   168 LA-------LIFFAIVNDLYFAYNVIMVLLWTIFCVLSIY 200
            |:       ::.|....|.:    ::.:.|:.:.||:|.|
  Fly   124 LSRRVKFDPIVGFIFTMDFF----LLCLNLYCLLCVISQY 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pasi2NP_649883.1 None
CG13288NP_001261455.1 DUF4728 75..163 CDD:292485 20/90 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR36694
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.