DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pasi2 and W06F12.2

DIOPT Version :9

Sequence 1:NP_649883.1 Gene:pasi2 / 41113 FlyBaseID:FBgn0037680 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001255211.1 Gene:W06F12.2 / 176809 WormBaseID:WBGene00012306 Length:572 Species:Caenorhabditis elegans


Alignment Length:217 Identity:42/217 - (19%)
Similarity:67/217 - (30%) Gaps:74/217 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 AIFLSLFTIATSI--FDIYCYAMAA-------------PGSTHYG-----YYIISY-----EFVY 109
            ||.:.::::.:|:  ..|..:.|.|             |....||     .|..||     |..|
 Worm    15 AITIGIWSLVSSMGQLGIMGWQMVAIKYERDRAANTLLPNYNTYGRFDIPSYFESYWQSPEERYY 79

  Fly   110 VGNKHVRNMLIVFALFSLIMALINFVTSVLLCVALRKEYERKVMPWL-----------------W 157
            .|       |.|..:..||.|......|..:...:....:..|.||.                 |
 Worm    80 TG-------LFVIQVLCLIAAFFLVFASAAMIYGIHTWSKYLVWPWFPVMLSSILATLAYCIMWW 137

  Fly   158 SFAIFTVWRALALIFFAIVNDLYFAYNVIMVLLWTIFCVLSIYGWAVVYSLFLELVDLTKLEDLA 222
            ...:.:.|.|:.:|             .|:|:...|:||       ||..::...::.|..|...
 Worm   138 CGDVRSYWLAITII-------------EIIVVFINIYCV-------VVVMMYYRRINATTDEYEG 182

  Fly   223 HLRMGTMASLHASTANSLAGSR 244
            ..|.|....:     |.:..||
 Worm   183 KDRRGVRYKI-----NRMGNSR 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pasi2NP_649883.1 None
W06F12.2NP_001255211.1 Glucos_trans_II 90..>175 CDD:304968 18/104 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR36694
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.