DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pasi2 and C18D11.1

DIOPT Version :9

Sequence 1:NP_649883.1 Gene:pasi2 / 41113 FlyBaseID:FBgn0037680 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001370046.1 Gene:C18D11.1 / 176611 WormBaseID:WBGene00007679 Length:263 Species:Caenorhabditis elegans


Alignment Length:196 Identity:38/196 - (19%)
Similarity:72/196 - (36%) Gaps:66/196 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 FAIFLSLFTIATSIFDIYCY----AMAAPG---------STHY---------------------- 98
            |...||:.|.|.:|:.:..|    .:||.|         ::||                      
 Worm    12 FCCGLSVATSAIAIYTLILYLLLSGLAAWGLSDTTQNGDASHYNSCELEAQGKINAENRKLTFTG 76

  Fly    99 GYYII------SY---------EFVY-VGNKHVRNMLIVFALFSLIMALINFVTSVLLCVALRKE 147
            |..::      ||         |..| ..|::|..::.:....||::|      |::|.:.|...
 Worm    77 GRTVVVVQDSTSYHCSLGLYTEELKYSASNRYVSLVIDILLYVSLVLA------SIVLLIGLCSY 135

  Fly   148 YERKVMPWLWSFAIFTVWRALALIFFAIVNDLYFAYNVIMVLLWTIFCV----LSIYGWAVVYSL 208
            .:..::||.: ..|..:.|....:||.    .:::|..:..:...||.:    |.|..|.::.:.
 Worm   136 NQWLLLPWAF-LMIIDIVRGFISVFFI----FWYSYGNLARIATGIFFLGLQFLHISLWMIIAAK 195

  Fly   209 F 209
            |
 Worm   196 F 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pasi2NP_649883.1 None
C18D11.1NP_001370046.1 alpha-crystallin-Hsps_p23-like <64..>113 CDD:412199 7/48 (15%)
DUF4728 122..199 CDD:374176 17/86 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR36694
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.