DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aduk and ULK2

DIOPT Version :9

Sequence 1:NP_731331.1 Gene:Aduk / 41112 FlyBaseID:FBgn0037679 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_016880913.1 Gene:ULK2 / 9706 HGNCID:13480 Length:1057 Species:Homo sapiens


Alignment Length:291 Identity:106/291 - (36%)
Similarity:168/291 - (57%) Gaps:31/291 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ITDFEILEK--LGAGSYATVYKARHKKQRTYH-AIKYVEMSTLSQTSRENLITEIRLLRELKHKY 67
            :.|||..::  :|.|::|.|::.||:::..:. |||.:....||: |:..|..||::|:||:|:.
Human     4 VGDFEYSKRDLVGHGAFAVVFRGRHRQKTDWEVAIKSINKKNLSK-SQILLGKEIKILKELQHEN 67

  Fly    68 IVTLQDFFWDDKNIYIVLEYCNAGNLSAF---------------------IRTKKALPESTCRYF 111
            ||.|.|......::::|:||||.|:|:.:                     :|.|..|.|.|.|.|
Human    68 IVALYDVQELPNSVFLVMEYCNGGDLADYLQGNCVCVSVFSKDSAAACLILRAKGTLSEDTIRVF 132

  Fly   112 LRQLAAAVQYMRANDVSHFDLKPQNLLLT---RGANNVS---LKVADFGFAQHLKLGEINQQLKG 170
            |.|:|||::.:.:..:.|.||||||:||:   |..::||   :|:||||||::|....:...|.|
Human   133 LHQIAAAMRILHSKGIIHRDLKPQNILLSYANRRKSSVSGIRIKIADFGFARYLHSNMMAATLCG 197

  Fly   171 SPLYMAPEIVRKHQYDAKADLWSIGVILYECLFGKAPYSSRTIEELLLRIRKAEAITLPPNARIS 235
            ||:|||||::....|||||||||||.::|:||.||.|:.:.:.::|.:...|..::........|
Human   198 SPMYMAPEVIMSQHYDAKADLWSIGTVIYQCLVGKPPFQANSPQDLRMFYEKNRSLMPSIPRETS 262

  Fly   236 NECHDLLRRLLAHEPTARISFADFFAHPFLD 266
            ....:||..||......|:.|..||:||||:
Human   263 PYLANLLLGLLQRNQKDRMDFEAFFSHPFLE 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdukNP_731331.1 S_TKc 9..265 CDD:214567 103/285 (36%)
PKc_like 13..264 CDD:304357 100/280 (36%)
MIT_2 274..348 CDD:239147
MIT 407..472 CDD:282117
ULK2XP_016880913.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0595
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1084750at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5656
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.