DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aduk and AT1G49180

DIOPT Version :9

Sequence 1:NP_731331.1 Gene:Aduk / 41112 FlyBaseID:FBgn0037679 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_175344.2 Gene:AT1G49180 / 841341 AraportID:AT1G49180 Length:408 Species:Arabidopsis thaliana


Alignment Length:265 Identity:87/265 - (32%)
Similarity:147/265 - (55%) Gaps:11/265 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ITDFEILEKLGAGSYATVYKARHKKQRTYHAIKYVEMSTLSQTSRENLITEIRLLRELKHKYIVT 70
            :.|:....||.....:||:.|:||.......:|..::|.|::..|:.|..|:..|..:.|..|:.
plant     4 LDDYIAKSKLSESLTSTVWLAKHKLTGEEAVMKCFDLSKLNRNLRDCLNNELEFLSSVDHPNIIR 68

  Fly    71 LQDFFWDDKNIYIVLEYCNAGNLSAFIRTKKALPESTCRYFLRQLAAAVQYMRANDVSHFDLKPQ 135
            |.....||..:.:|||||:.|.||::|:....:.|...:.|::|:.|.::.:..|.:.|.||||:
plant    69 LLHVSQDDDFLVMVLEYCDGGTLSSYIQRYGRVEEDIAKRFMKQIGAGLEIIHDNHIIHRDLKPE 133

  Fly   136 NLLLTRGANNVSLKVADFGFAQHLKLGEINQQLKGSPLYMAPEIVRKHQYDAKADLWSIGVILYE 200
            |:|:....:::.||:|||..|:.|..|:..:.:.|||.|||||:::..:|:.|||:||:|.||:|
plant   134 NILIDGSGDDLVLKIADFSLARKLHPGKYLETVCGSPFYMAPEVLQFQRYNEKADMWSVGAILFE 198

  Fly   201 CLFGKAPYSSRTIEELLLRIRKAEAITLPPNARI-----SNECHDLLRRLLAHEPTARISFADFF 260
            .|.|..|:......::|..|:.:.|:   |.:|:     ..:|.|:..|||:..|.|.:...|| 
plant   199 LLHGYPPFRGNNNVQVLRNIKSSTAL---PFSRLILQQMHPDCIDVCSRLLSINPAATLGIEDF- 259

  Fly   261 AHPFL 265
              |||
plant   260 --PFL 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdukNP_731331.1 S_TKc 9..265 CDD:214567 84/260 (32%)
PKc_like 13..264 CDD:304357 83/255 (33%)
MIT_2 274..348 CDD:239147
MIT 407..472 CDD:282117
AT1G49180NP_175344.2 STKc_ATG1_ULK_like 13..261 CDD:270911 82/253 (32%)
S_TKc 19..262 CDD:214567 82/248 (33%)
DnaQ_like_exo <248..321 CDD:299142 7/18 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 222 1.000 Domainoid score I706
eggNOG 1 0.900 - - E1_KOG0595
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 155 1.000 Inparanoid score I1673
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1084750at2759
OrthoFinder 1 1.000 - - FOG0003680
OrthoInspector 1 1.000 - - otm3171
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24348
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.