DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aduk and pdik1l

DIOPT Version :9

Sequence 1:NP_731331.1 Gene:Aduk / 41112 FlyBaseID:FBgn0037679 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001032789.2 Gene:pdik1l / 569665 ZFINID:ZDB-GENE-051113-236 Length:341 Species:Danio rerio


Alignment Length:326 Identity:75/326 - (23%)
Similarity:135/326 - (41%) Gaps:95/326 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FEILEKLGAGSYATVYKARHKKQRTYHAIKYVEMSTLSQTSRENLITEIRLLREL-----KHKYI 68
            :|:::::|.|||..||:|..::.....|:|.:...     |.||:...:|....|     :|..:
Zfish     8 YELIQEVGRGSYGVVYEAVVRQTGARVAVKKIRCH-----SPENVELALREFWALSSIQSQHPNV 67

  Fly    69 VTLQD-----------------------------------------FFWDDKNIYIVLEYCNAGN 92
            :.|::                                         :.|      .|:::|:.|:
Zfish    68 IHLEECVLQRDALAQRMSHGSSSSLYLELVETSLKGEITFDPCCAYYMW------FVMDFCDGGD 126

  Fly    93 LSAFIRTKKALPESTCRYFLRQLAAAVQYMRANDVSHFDLKPQNLLLTR-----GANNVSLKVAD 152
            ::|::.::|. ...|...|:.||.:|:.::..|.:.|.||||.|:|:::     |:...:|||||
Zfish   127 MNAYLLSRKP-SRKTNTSFMLQLGSALAFLHRNQIIHRDLKPDNILISQGRTPAGSPEPTLKVAD 190

  Fly   153 FGFAQHLKLGEINQQ------------LKGSPLYMAPEIVRKHQYDAKADLWSIGVILYEC---- 201
            ||.::......:|.:            ..|:..|||||:...| |.||||::::|||::..    
Zfish   191 FGLSKVCSGSGLNPEEPASVNKCFLSTACGTDFYMAPEVWEGH-YTAKADIFALGVIIWAMVERI 254

  Fly   202 ----------LFGKAPYSSRTI---EELLLRIRKAEAITLPPNARISN-ECHDLLRRLLAHEPTA 252
                      |.|........|   .|.||...|.| :.:|...:..| ....|:|.:|:..|..
Zfish   255 TFVDVETQKELLGSYVQQGEDIVPLGEALLENPKME-LNIPARKKSMNASMKQLIREMLSANPQE 318

  Fly   253 R 253
            |
Zfish   319 R 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdukNP_731331.1 S_TKc 9..265 CDD:214567 75/326 (23%)
PKc_like 13..264 CDD:304357 74/322 (23%)
MIT_2 274..348 CDD:239147
MIT 407..472 CDD:282117
pdik1lNP_001032789.2 STKc_PDIK1L 7..331 CDD:270879 75/326 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0595
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.