DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aduk and stk35

DIOPT Version :9

Sequence 1:NP_731331.1 Gene:Aduk / 41112 FlyBaseID:FBgn0037679 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001071084.1 Gene:stk35 / 568080 ZFINID:ZDB-GENE-061103-553 Length:406 Species:Danio rerio


Alignment Length:369 Identity:87/369 - (23%)
Similarity:150/369 - (40%) Gaps:116/369 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PRITDFEILEKLGAGSYATVYKARHKKQRTYHAIKYVEMSTLSQTSRENLITEIRLLREL--KHK 66
            ||   :.::.::|.|||..||:|..::.....|||.:......:.  |..:.|...|..|  :|:
Zfish    69 PR---YSLIREVGRGSYGVVYEAVARRSGARVAIKKLRCDAPEKV--ELALAEFWALASLEKRHE 128

  Fly    67 YIVTLQD-------------------------------------------FFWDDKNIYIVLEYC 88
            .:|.|::                                           :.|      .|:|:|
Zfish   129 NVVQLEECVLQRNGMAQKMSHGNKRNKQYLRLVETSLKGERILGYPEEPCYLW------FVMEFC 187

  Fly    89 NAGNLSAFIRTKKALPESTCRYFLRQLAAAVQYMRANDVSHFDLKPQNLLLTRGANNVSLKVADF 153
            :.|:|:.:|.:::..|. |.|.|::||.:||.::..|::.|.||||.|:|:::.:.|..:|||||
Zfish   188 DGGDLNQYILSRRPDPR-TNRSFMKQLTSAVAFLHKNNIVHRDLKPDNILISQKSGNPVIKVADF 251

  Fly   154 GFAQ-----------------HLKLGEINQ----QLKGSPLYMAPEIVRKHQYDAKADLWSIGVI 197
            |.::                 :..:..||:    ...||..|||||:...| |.||||::::|:|
Zfish   252 GLSKVCAGLSCMQNEGDDQVNNKNIVNINKFWLSSACGSDFYMAPEVWEGH-YTAKADIFALGII 315

  Fly   198 LYECLFGKAPYSSRTIEELL-LRIRKAEAIT---------------LPPNAR--ISNECHDLLRR 244
            ::..:.......:.:..||| ..:|:...|.               :|...|  :|.....||:.
Zfish   316 IWAMIERITFIDAESKRELLGTYVRQGTEIVPVGEALLENPKMVLHIPQKTRSIMSEGVKRLLQD 380

  Fly   245 LLAHEPTARISFADFFAHPFLDLKTFPTEHTLQKAIDLVTQACA 288
            :||..|..|                 |....|:..:|.||  ||
Zfish   381 MLAVNPQDR-----------------PDAFQLEVRMDQVT--CA 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdukNP_731331.1 S_TKc 9..265 CDD:214567 78/339 (23%)
PKc_like 13..264 CDD:304357 78/334 (23%)
MIT_2 274..348 CDD:239147 6/15 (40%)
MIT 407..472 CDD:282117
stk35NP_001071084.1 PKc_like 70..401 CDD:304357 81/360 (23%)
S_TKc 71..395 CDD:214567 79/350 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0595
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.