DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aduk and ulk1b

DIOPT Version :9

Sequence 1:NP_731331.1 Gene:Aduk / 41112 FlyBaseID:FBgn0037679 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_002665971.2 Gene:ulk1b / 558848 ZFINID:ZDB-GENE-071203-2 Length:1011 Species:Danio rerio


Alignment Length:290 Identity:116/290 - (40%)
Similarity:177/290 - (61%) Gaps:20/290 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FEILEK--LGAGSYATVYKARHKKQRTYH-AIKYVEMSTLSQTSRENLITEIRLLRELKHKYIVT 70
            ||...|  :|.|::|.|:|.||:::..:. |:|.:....|:: |:..|..||::|:||||:.||.
Zfish     7 FEFSRKDLIGHGAFAVVFKGRHREKHEWEVAVKCINKKNLAK-SQTLLGKEIKILKELKHENIVA 70

  Fly    71 LQDFFWDDKNIYIVLEYCNAGNLSAFIRTKKALPESTCRYFLRQLAAAVQYMRANDVSHFDLKPQ 135
            |.||.....::|:|:||||.|:|:.::.:|..|.|.|.|.||:|:..|::.::|..:.|.|||||
Zfish    71 LHDFQETASSVYLVMEYCNGGDLADYLHSKGTLSEDTIRVFLQQITGAMRVLQAKGIIHRDLKPQ 135

  Fly   136 NLLLTRGA------NNVSLKVADFGFAQHLKLGEINQQLKGSPLYMAPEIVRKHQYDAKADLWSI 194
            |:||:..|      ||..:|:||||||::|:...:...|.|||:|||||::....||||||||||
Zfish   136 NILLSHPAGRKSHFNNTCIKIADFGFARYLQNNMMAATLCGSPMYMAPEVIMSQNYDAKADLWSI 200

  Fly   195 GVILYECLFGKAPYSSRTIEELLLRIRKAEAITLPPN--ARISNECHDLLRRLLAHEPTARISFA 257
            |.|:::||.||||:.:.:.::|.|...|.:  ||.||  ...|.....||..||......|:.|.
Zfish   201 GTIVFQCLTGKAPFQASSPQDLRLFYEKNK--TLSPNIPRETSTHLRHLLLGLLQRNHKDRMDFD 263

  Fly   258 DFFAHPFLDLKTFPTEHTLQKAIDLVTQAC 287
            :||.||||:..:     :::|:.. ||..|
Zfish   264 EFFRHPFLEASS-----SMKKSTP-VTVTC 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdukNP_731331.1 S_TKc 9..265 CDD:214567 110/266 (41%)
PKc_like 13..264 CDD:304357 107/261 (41%)
MIT_2 274..348 CDD:239147 4/14 (29%)
MIT 407..472 CDD:282117
ulk1bXP_002665971.2 PKc_like 6..272 CDD:304357 111/267 (42%)
S_TKc 9..271 CDD:214567 108/264 (41%)
DUF3543 796..1007 CDD:288883
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0595
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1084750at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5656
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.