DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aduk and Ulk1

DIOPT Version :9

Sequence 1:NP_731331.1 Gene:Aduk / 41112 FlyBaseID:FBgn0037679 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_006249627.1 Gene:Ulk1 / 360827 RGDID:1589743 Length:1057 Species:Rattus norvegicus


Alignment Length:270 Identity:112/270 - (41%)
Similarity:166/270 - (61%) Gaps:10/270 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FEILEK--LGAGSYATVYKARHKKQRTYH-AIKYVEMSTLSQTSRENLITEIRLLRELKHKYIVT 70
            ||...|  :|.|::|.|:|.||:::.... |:|.:....|:: |:..|..||::|:||||:.||.
  Rat    14 FEFSRKDLIGHGAFAVVFKGRHREKHDLEVAVKCINKKNLAK-SQTLLGKEIKILKELKHENIVA 77

  Fly    71 LQDFFWDDKNIYIVLEYCNAGNLSAFIRTKKALPESTCRYFLRQLAAAVQYMRANDVSHFDLKPQ 135
            |.||.....::|:|:||||.|:|:.::.|.:.|.|.|.|.||:|:|.|:|.:.:..:.|.|||||
  Rat    78 LYDFQEMANSVYLVMEYCNGGDLADYLHTMRTLSEDTVRLFLQQIAGAMQLLHSKGIIHRDLKPQ 142

  Fly   136 NLLLT----RGAN--NVSLKVADFGFAQHLKLGEINQQLKGSPLYMAPEIVRKHQYDAKADLWSI 194
            |:||:    |.||  |:.:|:||||||::|:...:...|.|||:|||||::....||.|||||||
  Rat   143 NILLSNPGGRRANPSNIRVKIADFGFARYLQSNMMAATLCGSPMYMAPEVIMSQHYDGKADLWSI 207

  Fly   195 GVILYECLFGKAPYSSRTIEELLLRIRKAEAITLPPNARISNECHDLLRRLLAHEPTARISFADF 259
            |.|:|:||.||||:.:.:.::|.|...|.:.:........|.....||..||......|:.|.:|
  Rat   208 GTIVYQCLTGKAPFQASSPQDLRLFYEKNKTLVPAIPRETSAPLRQLLLALLQRNHKDRMDFDEF 272

  Fly   260 FAHPFLDLKT 269
            |.|||||..|
  Rat   273 FHHPFLDAST 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdukNP_731331.1 S_TKc 9..265 CDD:214567 108/264 (41%)
PKc_like 13..264 CDD:304357 105/259 (41%)
MIT_2 274..348 CDD:239147
MIT 407..472 CDD:282117
Ulk1XP_006249627.1 STKc_ULK1 13..279 CDD:271104 109/265 (41%)
S_TKc 16..278 CDD:214567 106/262 (40%)
DUF3543 844..1051 CDD:288883
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0595
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1084750at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.