DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aduk and Ulk2

DIOPT Version :9

Sequence 1:NP_731331.1 Gene:Aduk / 41112 FlyBaseID:FBgn0037679 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_006246559.1 Gene:Ulk2 / 303206 RGDID:1310181 Length:1059 Species:Rattus norvegicus


Alignment Length:270 Identity:106/270 - (39%)
Similarity:168/270 - (62%) Gaps:10/270 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ITDFEILEK--LGAGSYATVYKARHKKQRTYH-AIKYVEMSTLSQTSRENLITEIRLLRELKHKY 67
            :.|||..::  :|.|::|.|::.||:::..:. |||.:....||: |:..|..||::|:||:|:.
  Rat     4 VGDFEYSKRDLVGHGAFAVVFRGRHRQKTDWEVAIKSINKKNLSK-SQILLGKEIKILKELQHEN 67

  Fly    68 IVTLQDFFWDDKNIYIVLEYCNAGNLSAFIRTKKALPESTCRYFLRQLAAAVQYMRANDVSHFDL 132
            ||.|.|......::::|:||||.|:|:.:::.|..|.|.|.|.||.|:|||::.:.:..:.|.||
  Rat    68 IVALYDVQELPNSVFLVMEYCNGGDLADYLQAKGTLSEDTIRVFLHQIAAAMRILHSKGIIHRDL 132

  Fly   133 KPQNLLL---TRGANNVS---LKVADFGFAQHLKLGEINQQLKGSPLYMAPEIVRKHQYDAKADL 191
            ||||:||   :|..:|||   :|:||||||::|....:...|.|||:|||||::....|||||||
  Rat   133 KPQNILLSYASRRKSNVSGIRIKIADFGFARYLHSNTMAATLCGSPMYMAPEVIMSQHYDAKADL 197

  Fly   192 WSIGVILYECLFGKAPYSSRTIEELLLRIRKAEAITLPPNARISNECHDLLRRLLAHEPTARISF 256
            ||||.::|:||.||.|:.:.:.::|.:...|..::........|....:||..||......|:.|
  Rat   198 WSIGTVIYQCLVGKPPFQANSPQDLRMFYEKNRSLMPSIPRETSPYLANLLLGLLQRNQKDRMDF 262

  Fly   257 ADFFAHPFLD 266
            ..||:||||:
  Rat   263 EAFFSHPFLE 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdukNP_731331.1 S_TKc 9..265 CDD:214567 103/264 (39%)
PKc_like 13..264 CDD:304357 100/259 (39%)
MIT_2 274..348 CDD:239147
MIT 407..472 CDD:282117
Ulk2XP_006246559.1 STKc_ULK2 2..272 CDD:271103 105/268 (39%)
S_TKc 9..271 CDD:214567 101/262 (39%)
DUF3543 <865..1052 CDD:288883
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0595
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1084750at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.