DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aduk and PDIK1L

DIOPT Version :9

Sequence 1:NP_731331.1 Gene:Aduk / 41112 FlyBaseID:FBgn0037679 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001230461.1 Gene:PDIK1L / 149420 HGNCID:18981 Length:341 Species:Homo sapiens


Alignment Length:331 Identity:74/331 - (22%)
Similarity:143/331 - (43%) Gaps:83/331 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FEILEKLGAGSYATVYKARHKKQRTYHAIKYV-------------EMSTLSQTS---------RE 51
            ::::.::|.|||..||:|..:|.....|:|.:             |...||...         .|
Human     8 YDLIREVGRGSYGVVYEAVIRKTSARVAVKKIRCHAPENVELALREFWALSSIKSQHPNVIHLEE 72

  Fly    52 NLITEIRLLRELKH-----KYIVTLQ-----DFFWDDKNIY---IVLEYCNAGNLSAFIRTKKAL 103
            .::.:..:::::.|     .|:..::     :..:|.::.|   .|:::|:.|:::.::.::|. 
Human    73 CILQKDGMVQKMSHGSNSSLYLQLVETSLKGEIAFDPRSAYYLWFVMDFCDGGDMNEYLLSRKP- 136

  Fly   104 PESTCRYFLRQLAAAVQYMRANDVSHFDLKPQNLLLTRGANNVS-----LKVADFGFAQHLKLGE 163
            ...|...|:.||::|:.::..|.:.|.||||.|:|:::...:.|     |||||||.::......
Human   137 NRKTNTSFMLQLSSALAFLHKNQIIHRDLKPDNILISQTRLDTSDLEPTLKVADFGLSKVCSASG 201

  Fly   164 INQQ------------LKGSPLYMAPEIVRKHQYDAKADLWSIGVILYECLFGKAPYSSRTIEEL 216
            .|.:            ..|:..|||||:...| |.||||::::|:|::..|.......:.|.:||
Human   202 QNPEEPVSVNKCFLSTACGTDFYMAPEVWEGH-YTAKADIFALGIIIWAMLERITFIDTETKKEL 265

  Fly   217 -----------------LLRIRKAEAITLPPNARISNECHDLLRRLLAHEPTAR----------- 253
                             ||...|.|.:.......::.....|::.:||..|..|           
Human   266 LGSYVKQGTEIVPVGEALLENPKMELLIPVKKKSMNGRMKQLIKEMLAANPQDRPDAFELELRLV 330

  Fly   254 -ISFAD 258
             |:|.|
Human   331 QIAFKD 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdukNP_731331.1 S_TKc 9..265 CDD:214567 74/331 (22%)
PKc_like 13..264 CDD:304357 74/327 (23%)
MIT_2 274..348 CDD:239147
MIT 407..472 CDD:282117
PDIK1LNP_001230461.1 STKc_PDIK1L 7..331 CDD:270879 71/324 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0595
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.