DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aduk and STK35

DIOPT Version :9

Sequence 1:NP_731331.1 Gene:Aduk / 41112 FlyBaseID:FBgn0037679 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_543026.2 Gene:STK35 / 140901 HGNCID:16254 Length:534 Species:Homo sapiens


Alignment Length:370 Identity:92/370 - (24%)
Similarity:148/370 - (40%) Gaps:121/370 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PRITDFEILEKLGAGSYATVYKARHKKQRTYHAIKYVEMSTLSQTSRENL---ITEIRLLRELK- 64
            ||   :.:|.::|.|||..||:|...:.....|:|.:...     :.||:   :.|...|..|| 
Human   200 PR---YSLLAEIGRGSYGVVYEAVAGRSGARVAVKKIRCD-----APENVELALAEFWALTSLKR 256

  Fly    65 -HKYIVTLQD-------------------------------------------FFWDDKNIYIVL 85
             |:.:|..::                                           :.|      .|:
Human   257 RHQNVVQFEECVLQRNGLAQRMSHGNKSSQLYLRLVETSLKGERILGYAEEPCYLW------FVM 315

  Fly    86 EYCNAGNLSAFIRTKKALPESTCRYFLRQLAAAVQYMRANDVSHFDLKPQNLLLTRGANNVSLKV 150
            |:|..|:|:.::.:::..| :|.:.|:.||.:|:.::..|.:.|.||||.|:|:|..:....|||
Human   316 EFCEGGDLNQYVLSRRPDP-ATNKSFMLQLTSAIAFLHKNHIVHRDLKPDNILITERSGTPILKV 379

  Fly   151 ADFGFAQHLKLG------EINQQLK-------------GSPLYMAPEIVRKHQYDAKADLWSIGV 196
            ||||.:: :..|      |.||..|             ||..|||||:...| |.||||::::|:
Human   380 ADFGLSK-VCAGLAPRGKEGNQDNKNVNVNKYWLSSACGSDFYMAPEVWEGH-YTAKADIFALGI 442

  Fly   197 ILYECLFGKAPYSSRTIEELL-LRIRKAEAITLPPNARISN---ECH--------------DLLR 243
            |::..:.......|.|.:||| ..|::...|.....|.:.|   |.|              .||:
Human   443 IIWAMIERITFIDSETKKELLGTYIKQGTEIVPVGEALLENPKMELHIPQKRRTSMSEGIKQLLK 507

  Fly   244 RLLAHEPTARISFADFFAHPFLDLKTFPTEHTLQKAIDLVTQACA 288
            .:||..|..|                 |....|:..:|.||  ||
Human   508 DMLAANPQDR-----------------PDAFELETRMDQVT--CA 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdukNP_731331.1 S_TKc 9..265 CDD:214567 83/340 (24%)
PKc_like 13..264 CDD:304357 82/335 (24%)
MIT_2 274..348 CDD:239147 6/15 (40%)
MIT 407..472 CDD:282117
STK35NP_543026.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 32..176
STKc_PDIK1L 201..529 CDD:270879 86/361 (24%)
S_TKc 202..523 CDD:214567 84/351 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0595
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.