DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aduk and ulk2

DIOPT Version :9

Sequence 1:NP_731331.1 Gene:Aduk / 41112 FlyBaseID:FBgn0037679 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_004911684.1 Gene:ulk2 / 100487396 XenbaseID:XB-GENE-6041491 Length:1073 Species:Xenopus tropicalis


Alignment Length:270 Identity:107/270 - (39%)
Similarity:166/270 - (61%) Gaps:10/270 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ITDFEILEK--LGAGSYATVYKARHKKQRTYH-AIKYVEMSTLSQTSRENLITEIRLLRELKHKY 67
            :.|||...|  :|.|::|.|:|.||:|:..:. |||.:....||: |:..|..||::|:||:|:.
 Frog     4 VGDFEYSRKDLIGHGAFAVVFKGRHRKKTDWEVAIKSINKKNLSK-SQILLGKEIKILKELQHEN 67

  Fly    68 IVTLQDFFWDDKNIYIVLEYCNAGNLSAFIRTKKALPESTCRYFLRQLAAAVQYMRANDVSHFDL 132
            ||.|.|......::::|:|:||.|:|:.:::.|..|.|.|.|.||:|:|||::.:.:..:.|.||
 Frog    68 IVALYDVQEMPNSVFLVMEFCNGGDLADYLQAKGTLSEDTIRIFLQQIAAAMRVLHSKGIIHRDL 132

  Fly   133 KPQNLLLTRGA------NNVSLKVADFGFAQHLKLGEINQQLKGSPLYMAPEIVRKHQYDAKADL 191
            ||||:||:..:      :.:.:|:||||||::|:...:...|.|||:|||||::....|||||||
 Frog   133 KPQNILLSYASRKKATFSGIRIKIADFGFARYLQSNMMAATLCGSPMYMAPEVIMSQHYDAKADL 197

  Fly   192 WSIGVILYECLFGKAPYSSRTIEELLLRIRKAEAITLPPNARISNECHDLLRRLLAHEPTARISF 256
            ||||.::|:||.||.|:.:.:.::|.|...|.:.:........|....|||..||......|:.|
 Frog   198 WSIGTVIYQCLVGKPPFQANSPQDLRLFYEKNKNLVPSIPRETSAYLSDLLLALLQRNQKDRLDF 262

  Fly   257 ADFFAHPFLD 266
            ..||.|||||
 Frog   263 EGFFNHPFLD 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdukNP_731331.1 S_TKc 9..265 CDD:214567 103/264 (39%)
PKc_like 13..264 CDD:304357 100/259 (39%)
MIT_2 274..348 CDD:239147
MIT 407..472 CDD:282117
ulk2XP_004911684.1 STKc_ULK2 2..272 CDD:271103 105/268 (39%)
DUF3543 881..1064 CDD:371876
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1084750at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.