DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and KLK4

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_004908.4 Gene:KLK4 / 9622 HGNCID:6365 Length:254 Species:Homo sapiens


Alignment Length:259 Identity:79/259 - (30%)
Similarity:128/259 - (49%) Gaps:32/259 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 FALLTTAG--ISHGAPQMGRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAHCTD 74
            :.:|..||  :|....|   ::||.|.|....|:..:: .......|.|.::..|:|::||||..
Human    14 YLILGVAGSLVSGSCSQ---IINGEDCSPHSQPWQAAL-VMENELFCSGVLVHPQWVLSAAHCFQ 74

  Fly    75 GRKASDLSVQYGVTKINA---TGPNVVRVKKIIQHEDYN-PYNNYANDISLLLVEEPF-EFDGVT 134
                :..::..|:..:.|   .|..:|.....::|.:|| |.  .|||:.|:.::|.. |.|.:.
Human    75 ----NSYTIGLGLHSLEADQEPGSQMVEASLSVRHPEYNRPL--LANDLMLIKLDESVSESDTIR 133

  Fly   135 VAPVKLPELAFATPQTDAGGEGVLIGWGLNATGGYIQSTLQEVELKVYSDEECTERHGGRTDPRY 199
                   .::.|:....||...::.||||.| .|.:.:.||.|.:.|.|:|.|::.:    ||.|
Human   134 -------SISIASQCPTAGNSCLVSGWGLLA-NGRMPTVLQCVNVSVVSEEVCSKLY----DPLY 186

  Fly   200 H---ICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIKKS 260
            |   .|.|..:..|..|:||||||||.||...|:||:...||.....||||..:.::.:||:|:
Human   187 HPSMFCAGGGQDQKDSCNGDSGGPLICNGYLQGLVSFGKAPCGQVGVPGVYTNLCKFTEWIEKT 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 71/235 (30%)
Tryp_SPc 30..259 CDD:238113 73/236 (31%)
KLK4NP_004908.4 Tryp_SPc 31..250 CDD:238113 73/237 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 157 1.000 Inparanoid score I4287
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.