DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and Prss8

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_579929.1 Gene:Prss8 / 76560 MGIID:1923810 Length:339 Species:Mus musculus


Alignment Length:258 Identity:80/258 - (31%)
Similarity:123/258 - (47%) Gaps:33/258 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SHGAPQMGRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAHC---TDGRKASDLS 82
            |.||....|:..|..:...::|:.:|:. ..|:|.||||::|.::|::||||   ...|:|.:  
Mouse    36 SCGAVIQPRITGGGSAKPGQWPWQVSIT-YDGNHVCGGSLVSNKWVVSAAHCFPREHSREAYE-- 97

  Fly    83 VQYGVTKINATGPNVV--RVKKIIQHEDYNPYNNYANDISLLLVEEPFEFDGVTVAPVKLPELAF 145
            |:.|..::::...:.|  .|.:||.|..|....: ..||:|:.:..|..|... :.|:.||....
Mouse    98 VKLGAHQLDSYSNDTVVHTVAQIITHSSYREEGS-QGDIALIRLSSPVTFSRY-IRPICLPAANA 160

  Fly   146 ATPQTDAGGEGVLIGWGLNATGGYIQS--TLQEVELKVYSDEECT----------ERHGGRTDPR 198
            :.|.   |....:.|||..|....:|:  .||::|:.:.|.|.|:          |.|..:.|  
Mouse   161 SFPN---GLHCTVTGWGHVAPSVSLQTPRPLQQLEVPLISRETCSCLYNINAVPEEPHTIQQD-- 220

  Fly   199 YHICGGVDEGGKGQCSGDSGGPLIYNGQQV----GIVSWSIKPCTVAPYPGVYCKVSQYVDWI 257
             .:|.|..:|||..|.|||||||....:.:    |||||. ..|.....||||...|.|..||
Mouse   221 -MLCAGYVKGGKDACQGDSGGPLSCPMEGIWYLAGIVSWG-DACGAPNRPGVYTLTSTYASWI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 75/248 (30%)
Tryp_SPc 30..259 CDD:238113 76/249 (31%)
Prss8NP_579929.1 Tryp_SPc 45..284 CDD:238113 76/249 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.