DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and 1810009J06Rik

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_076196.1 Gene:1810009J06Rik / 73626 MGIID:1920876 Length:247 Species:Mus musculus


Alignment Length:255 Identity:86/255 - (33%)
Similarity:127/255 - (49%) Gaps:17/255 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LAVFALLTTAGISHGAPQMGRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAHCT 73
            :..|.....|.::..|....::|.|........|:.:|:.... ||.||||:||.|:|::||||.
Mouse     3 IITFFTFLGAAVALPANSDDKIVGGYTCPKHSVPYQVSLNDGI-SHQCGGSLISDQWVLSAAHCY 66

  Fly    74 DGRKASDLSVQYGVTKINAT--GPNVVRVKKIIQHEDYNPYNNYANDISLLLVEEPFEFDGVTVA 136
            ..|    |.|:.|...|:..  |...:..:|||:|.|||. :...|||.|:.::.|...:. .|:
Mouse    67 KRR----LQVRLGEHNIDVLEGGEQFIDAEKIIRHPDYNK-DTVDNDIMLIKLKSPAILNS-QVS 125

  Fly   137 PVKLPELAFATPQTDAGGEGVLIGWGLNAT-GGYIQSTLQEVELKVYSDEECTERHGGRTDPRYH 200
            .|.||....:|     ..:.::.|||...: ||...:.||.:|..|.|...|.:.:.|:..... 
Mouse   126 TVSLPRSCAST-----NAQCLVSGWGNTVSIGGKYPALLQCLEAPVLSASSCKKSYPGQITSNM- 184

  Fly   201 ICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIKKS 260
            .|.|..||||..|.||||||::.||:..|||||. ..|.:...||||.||..|:.||:::
Mouse   185 FCLGFLEGGKDSCDGDSGGPVVCNGEIQGIVSWG-SVCAMRGKPGVYTKVCNYLSWIQET 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 81/230 (35%)
Tryp_SPc 30..259 CDD:238113 83/231 (36%)
1810009J06RikNP_076196.1 Tryp_SPc 23..240 CDD:214473 81/230 (35%)
Tryp_SPc 24..243 CDD:238113 83/232 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.