DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and Klk10

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_598473.1 Gene:Klk10 / 69540 MGIID:1916790 Length:278 Species:Mus musculus


Alignment Length:268 Identity:70/268 - (26%)
Similarity:118/268 - (44%) Gaps:43/268 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 AVFALLTTAGISHGAPQMGRVVNGTDSSVEKYPFVISMRGSSGSHS----CGGSIISKQFVMTAA 70
            |..|||    :...|.::....:|.....:.:|:.:|:     .|:    |.|.::.:.:|:|||
Mouse    31 AAQALL----LPGNATRVDLEASGAQCERDYHPWQVSL-----FHNLQFQCAGVLVDQNWVLTAA 86

  Fly    71 HC-----TDGRKASDLSVQYGVTKINATGPNVVRVKKIIQHEDYN-------PYNNYANDISLLL 123
            ||     ...|...|..:.:...::.:|...|.       |..|.       |:.:..:|:.:|.
Mouse    87 HCWRNKPLRARVGDDHLLLFQKEQLRSTSSPVF-------HPKYQACSGPILPHRSDEHDLMMLK 144

  Fly   124 VEEPFEFDGVTVAPVKLPELAFATPQTDAGGEGVLIGWGLNATG--GYIQSTLQEVELKVYSDEE 186
            :..|..... .|.||:||   |...|  .|.|..:.|||.:|:.  .|.:| |...::.:.|.::
Mouse   145 LSSPVMLTS-NVHPVQLP---FRCSQ--PGQECQVSGWGTSASRRVKYNRS-LSCSKVTLLSQKQ 202

  Fly   187 CTERHGGRTDPRYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVS 251
            |...:.| ......||...| |.:..|..||||||:.:....|::||.|.||..|.:|.||.::.
Mouse   203 CETFYPG-VITNSMICAEAD-GNQDSCQSDSGGPLVCDDTLHGVLSWGIYPCGAAQHPSVYSEIC 265

  Fly   252 QYVDWIKK 259
            :|..||::
Mouse   266 KYTPWIRR 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 63/245 (26%)
Tryp_SPc 30..259 CDD:238113 65/246 (26%)
Klk10NP_598473.1 Tryp_SPc 50..271 CDD:214473 63/241 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 158 1.000 Inparanoid score I4246
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.