DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and Klk12

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_081373.1 Gene:Klk12 / 69511 MGIID:1916761 Length:247 Species:Mus musculus


Alignment Length:253 Identity:81/253 - (32%)
Similarity:116/253 - (45%) Gaps:19/253 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 AVFALLTTAGISHGAPQMGRVVNGTDSSVEKYPFVISMRGSSGSH-SCGGSIISKQFVMTAAHCT 73
            ::..||...|:|....:  ::.||.:......|:.:.:  ..|.: .|||.::.:::|:|||||.
Mouse     4 SILLLLCAVGLSQADRE--KIYNGVECVKNSQPWQVGL--FHGKYLRCGGVLVDRKWVLTAAHCR 64

  Fly    74 DGRKASDLSVQYGVTKINATGPNVVRVKKIIQHEDY-NPYNNYANDISLLLVEEPFEFDGVTVAP 137
            |  |......::.:||::.| ..:......|.|..| ..|.|:.:|:.||.:..|..... .|.|
Mouse    65 D--KYVVRLGEHSLTKLDWT-EQLRHTTFSITHPSYQGAYQNHEHDLRLLRLNRPIHLTR-AVRP 125

  Fly   138 VKLPELAFATPQTDAGGEGVLIGWG-LNATGGYIQSTLQEVELKVYSDEECTERHGGRTDPRYHI 201
            |.||.....|     |....:.||| .|.........||.:.|...|:|.|.....||.......
Mouse   126 VALPSSCVTT-----GAMCHVSGWGTTNKPWDPFPDRLQCLNLSTVSNETCRAVFPGRVTENMLC 185

  Fly   202 CGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSW-SIKPCTVAPYPGVYCKVSQYVDWIK 258
            .||  |.||..|.|||||||:..|...|:||| |:.||.....||||.||.:|.|||:
Mouse   186 AGG--EAGKDACQGDSGGPLVCGGVLQGLVSWGSVGPCGQKGIPGVYTKVCKYTDWIR 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 75/231 (32%)
Tryp_SPc 30..259 CDD:238113 77/233 (33%)
Klk12NP_081373.1 Tryp_SPc 21..240 CDD:214473 75/231 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 158 1.000 Inparanoid score I4246
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.