DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and Klk5

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_081082.1 Gene:Klk5 / 68668 MGIID:1915918 Length:293 Species:Mus musculus


Alignment Length:237 Identity:73/237 - (30%)
Similarity:119/237 - (50%) Gaps:23/237 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAHCTDGRKASDLSVQYG---VTKI 90
            |:|||:|...:..|:..::........||..:||.|:::|||||   ||.. ..::.|   ::.:
Mouse    67 RIVNGSDCQKDAQPWQGALLLGPNKLYCGAVLISPQWLLTAAHC---RKPV-FRIRLGHHSMSPV 127

  Fly    91 NATGPNVVRVKKIIQHEDYNPYNNYANDISLLLVEEPFEFDGVTVAPVKLPELAFATPQTDAGGE 155
            ..:|..:.:..|.|.|..|: :..::||:.|:.:..... |..:|.||::        ..|...|
Mouse   128 YESGQQMFQGIKSIPHPGYS-HPGHSNDLMLIKMNRKIR-DSHSVKPVEI--------ACDCATE 182

  Fly   156 G---VLIGWGLNATG-GYIQSTLQEVELKVYSDEECTERHGGRTDPRYHICGGVDEGGKGQCSGD 216
            |   ::.|||..::. ......||.:.:.|.|:|.|...:.|:.| :...|.| ||.|:..|.||
Mouse   183 GTRCMVSGWGTTSSSHNNFPKVLQCLNITVLSEERCKNSYPGQID-KTMFCAG-DEEGRDSCQGD 245

  Fly   217 SGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIK 258
            ||||::.||:..|:|||...||.....||||..:.::|.|||
Mouse   246 SGGPVVCNGKLQGLVSWGDFPCAQRNRPGVYTNLCEFVKWIK 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 70/234 (30%)
Tryp_SPc 30..259 CDD:238113 72/236 (31%)
Klk5NP_081082.1 Tryp_SPc 67..286 CDD:214473 70/234 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 158 1.000 Inparanoid score I4246
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.