DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and LOC683849

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_003749780.1 Gene:LOC683849 / 683849 RGDID:1597830 Length:246 Species:Rattus norvegicus


Alignment Length:254 Identity:88/254 - (34%)
Similarity:130/254 - (51%) Gaps:21/254 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LAVFALLTTAGISHGAPQMGRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAHCT 73
            |.:.||:.|| ::.......::|.|........|:.:|:  :||.|.||||:|:.|:|::||||.
  Rat     4 LLILALVGTA-VAFPVDDDDKIVGGYTCQENSVPYQVSL--NSGYHFCGGSLINDQWVVSAAHCY 65

  Fly    74 DGRKASDLSVQYGVTKINATGPN--VVRVKKIIQHEDYNPYNNYANDISLLLVEEPFEFDGVTVA 136
            ..|    :.|:.|...||....|  .|...|||:|.::: .....|||.|:.:..|.:.: ..||
  Rat    66 KSR----IQVRLGEHNINVLEGNEQFVNAAKIIKHPNFD-RKTLNNDIMLIKLSSPVKLN-ARVA 124

  Fly   137 PVKLPELAFATPQTDAGGEGVLIGWGLNATGGYIQ-STLQEVELKVYSDEECTERHGGR-TDPRY 199
            .|.||...     ..||.:.::.|||...:.|..: ..||.::..:....:|...:.|: ||.. 
  Rat   125 TVALPSSC-----APAGTQCLISGWGNTLSFGVNEPDLLQCLDAPLLPQADCEASYPGKITDNM- 183

  Fly   200 HICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIK 258
             :|.|..||||..|.||||||::.||:..|||||.. .|.:...||||.||..|||||:
  Rat   184 -VCAGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGY-GCALPDNPGVYTKVCNYVDWIE 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 81/231 (35%)
Tryp_SPc 30..259 CDD:238113 83/233 (36%)
LOC683849XP_003749780.1 Tryp_SPc 23..239 CDD:214473 81/231 (35%)
Tryp_SPc 24..242 CDD:238113 83/233 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.