DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and Klk13

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001034131.2 Gene:Klk13 / 626834 MGIID:3615275 Length:276 Species:Mus musculus


Alignment Length:285 Identity:91/285 - (31%)
Similarity:130/285 - (45%) Gaps:62/285 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LAVFALLTTA---GISHGAPQMGRVVNGTDSSVEKYPFVISMRGSSG---------SHS------ 55
            :|..|.||.|   |||...|   :::|||:             |:||         .||      
Mouse     5 VATIACLTLALSEGISRDYP---KILNGTN-------------GTSGFLPGGYTCLPHSQPWQAA 53

  Fly    56 --------CGGSIISKQFVMTAAHC-TDGRKASDLSVQYGVTKIN--ATGPNVVRVKKIIQHEDY 109
                    |||.::..::|:||||| .||     .:|..|...:.  ..|...:.|.:.|.|.:|
Mouse    54 LLIRGRLLCGGVLVHPKWVLTAAHCRKDG-----YTVHLGKHALGRVENGEQAMEVVRSIPHPEY 113

  Fly   110 N---PYNNYANDISLLLVEEPFEFDGVTVAPVKLPELAFATPQTDAGGEGVLIGWGLNATGGYIQ 171
            .   .:.|:.:||.||.::.|.:... .|..:||.    |......|....:.||| ..|...:.
Mouse   114 QVTPTHLNHDHDIMLLELKSPVQLSS-HVRTLKLS----ADDCLPTGTCCRVSGWG-TTTSPQVN 172

  Fly   172 --STLQEVELKVYSDEECTERHGGRTDPRYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWS 234
              .|||...:::.|||||.:.:.|:..... :|.|..||||..|.||||||||.||:..||:||.
Mouse   173 YPKTLQCANIELRSDEECRQVYPGKITANM-LCAGTKEGGKDSCEGDSGGPLICNGKLYGIISWG 236

  Fly   235 IKPCTVAPYPGVYCKVSQYVDWIKK 259
            ..||.....||||.:||:|:.||::
Mouse   237 DFPCGQPNRPGVYTRVSKYLRWIRE 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 80/258 (31%)
Tryp_SPc 30..259 CDD:238113 82/259 (32%)
Klk13NP_001034131.2 Tryp_SPc 39..262 CDD:238113 76/235 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 158 1.000 Inparanoid score I4246
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.