DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and CG17242

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001259921.1 Gene:CG17242 / 59226 FlyBaseID:FBgn0250841 Length:245 Species:Drosophila melanogaster


Alignment Length:261 Identity:66/261 - (25%)
Similarity:111/261 - (42%) Gaps:34/261 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LCLAVFALLTTAGISHGAPQMGRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAH 71
            |...:..|::.|.|:.....:|         :|:.|:..|:: .:..|.|||.|.|:..::|.|.
  Fly     2 LLKGILLLVSIAQIAADFKSIG---------IEQAPWQASVQ-INDKHHCGGVIYSEDIILTIAE 56

  Fly    72 CTDGRKASDLSVQYGVTKINATGPNVVRVKKI-IQHEDYNPYNNYANDISLLLVEEPFEFDG--- 132
            |....:...:||:.|..:.|| |..|::|:|: :|.....|     :|:::|.:..|...||   
  Fly    57 CVRKARLEFISVRVGSAQENA-GGTVLKVEKMRLQVLGLRP-----SDVAILQLRSPLYLDGGIR 115

  Fly   133 -VTVAPVKLPELAFATPQTDAGGEGVLIGWGLNATGGYIQSTLQEVELKVYSDEECTERHG--GR 194
             :.:|.:.|      .|.|:|.    :.|||..:........|..|::|:.....|.....  ||
  Fly   116 AIPLATIPL------VPGTNAS----VSGWGQLSAMNPSSEVLLRVDVKIQDQLMCATNLALKGR 170

  Fly   195 TDPRYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIKK 259
            ......||..........|.|..||||:.|.:..||:||. ..|.|.....||..::.:..||:.
  Fly   171 LMSVGEICAAPAGEIPYACQGFVGGPLVANNRLYGILSWQ-SACDVLNKSSVYANIAMFKVWIES 234

  Fly   260 S 260
            :
  Fly   235 T 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 59/234 (25%)
Tryp_SPc 30..259 CDD:238113 61/235 (26%)
CG17242NP_001259921.1 Tryp_SPc 24..235 CDD:238113 61/228 (27%)
Tryp_SPc 24..232 CDD:214473 59/225 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.