DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and CG17239

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster


Alignment Length:248 Identity:82/248 - (33%)
Similarity:122/248 - (49%) Gaps:22/248 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ALLTTAGISHGAPQMGRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAHCTDGRK 77
            |...|...|:..|:  |:|.|...::...|:..|:. ..|...||.:|.|:..|:|||||...|:
  Fly     9 AFSVTVVSSNWIPE--RIVGGDLITILSVPWQASIL-RLGRFHCGAAIYSEDIVITAAHCLTDRE 70

  Fly    78 ASDLSVQYGVTKINATGPNVVRVKKIIQHEDYNPYNNYANDISLLLVEEPFEFDGVTVAPVKLPE 142
            ...|||:.| :.....|..||||..::.||:|:  .:::|||:::.::..... |..|:.:.|.:
  Fly    71 TEFLSVRVG-SSFTFFGGQVVRVSSVLLHEEYD--QSWSNDIAVMRLQSKLRL-GSAVSVIPLAD 131

  Fly   143 LAFATPQTDAGGEGVLIGWGLNATG---GYIQSTLQEVELKVYSDEECTERHGGRTDPRYHICGG 204
                ||.. :|....:.|||  |.|   .|..|.| ...:.:...::| .|..||...:..||..
  Fly   132 ----TPPA-SGSPATVSGWG--AIGFKKNYPMSIL-SASVDIVDQDQC-RRSYGRKITKDMICAA 187

  Fly   205 VDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWI 257
            ..  ||..|||||||||:...:.|||||:. |.|....|||||..|::...||
  Fly   188 AP--GKDACSGDSGGPLVSGNKLVGIVSFG-KECAHPEYPGVYANVAELKPWI 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 76/230 (33%)
Tryp_SPc 30..259 CDD:238113 77/231 (33%)
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 76/230 (33%)
Tryp_SPc 24..237 CDD:238113 75/229 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D104239at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.