DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and CG34458

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001097340.1 Gene:CG34458 / 5740868 FlyBaseID:FBgn0085487 Length:257 Species:Drosophila melanogaster


Alignment Length:233 Identity:66/233 - (28%)
Similarity:113/233 - (48%) Gaps:10/233 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAHCTDGRKASDLSVQYGVTKINAT 93
            |::.|..::..::|..:|:: .:|.|.||||:||...::||||||.|:....:....|...::|.
  Fly    31 RIIGGQFAAPGQFPHQVSLQ-LNGRHHCGGSLISDTMIVTAAHCTMGQNPGQMKAIVGTNDLSAG 94

  Fly    94 GPNVVRVKKIIQHEDYNPYNNYANDISLLLVEEPFEFDGVTVAPVKLPELAFATPQTDAGGEGVL 158
            ......:.:.|.|..||| .:...|:||:.:..|....|.    |:..:||.:.....|....::
  Fly    95 NGQTFNIAQFIIHPRYNP-QSQDFDMSLIKLSSPVPMGGA----VQTIQLADSDSNYAADTMAMI 154

  Fly   159 IGWGLNATGGYIQSTLQEVELKVYSDEECTERH-GGRTDPRYHICGGVDEGGKGQCSGDSGGPLI 222
            .|:|.......:.:.|:..:::::|.:.|..:: .|.||..  :|.|...|....|.|||||||.
  Fly   155 SGFGAINQNLQLPNRLKFAQVQLWSRDYCNSQNIPGLTDRM--VCAGHPSGQVSSCQGDSGGPLT 217

  Fly   223 YNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIKKS 260
            .:|:..|:|||.. .|.....|.:|..|.....|||::
  Fly   218 VDGKLFGVVSWGF-GCGAKGRPAMYTYVGALRSWIKQN 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 63/228 (28%)
Tryp_SPc 30..259 CDD:238113 64/229 (28%)
CG34458NP_001097340.1 Tryp_SPc 31..251 CDD:214473 63/228 (28%)
Tryp_SPc 32..254 CDD:238113 65/230 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D104239at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.