DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and Klk4

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_064312.1 Gene:Klk4 / 56640 MGIID:1861379 Length:255 Species:Mus musculus


Alignment Length:258 Identity:75/258 - (29%)
Similarity:116/258 - (44%) Gaps:30/258 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CLAVFALLTTAGISHGAPQMGRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAHC 72
            ||    :|...|.| .:....|::.|.|.|....|:..::....| ..|.|.::..|:|::||||
Mouse    15 CL----ILEVTGAS-ASSVSSRIIQGQDCSPHSQPWQAALFSEDG-FFCSGVLVHPQWVLSAAHC 73

  Fly    73 TDGRKASDLSVQYGVTKINAT---GPNVVRVKKIIQHEDYNPYNNYANDISLL-LVEEPFEFDGV 133
            ..    ....|..|:..:..:   |..::.....|||.::|. .::|||:.|: |.|...|.:.:
Mouse    74 LQ----ESYIVGLGLHNLKGSQEPGSRMLEAHLSIQHPNFND-PSFANDLMLIKLNESVIESNTI 133

  Fly   134 TVAPVKLPELAFATPQTDAGGEGVLIGWGLNATGGYIQSTLQEVELKVYSDEECTERHGGRTDPR 198
            ...||       ||.....|...::.||| ....|.:.|.||.|.|.|.|:|.|...:    ||.
Mouse   134 RSIPV-------ATQCPTPGDTCLVSGWG-QLKNGKLPSLLQCVNLSVASEETCRLLY----DPV 186

  Fly   199 YHI---CGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIK 258
            ||:   |.|..:..|..|:||||||::.|....|:||.....|.....|.||..:.::.:||:
Mouse   187 YHLSMFCAGGGQDQKDSCNGDSGGPIVCNRSLQGLVSMGQGKCGQPGIPSVYTNLCKFTNWIQ 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 68/234 (29%)
Tryp_SPc 30..259 CDD:238113 69/236 (29%)
Klk4NP_064312.1 Tryp_SPc 32..251 CDD:238113 69/236 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 158 1.000 Inparanoid score I4246
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.