DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and PRTN3

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_002768.3 Gene:PRTN3 / 5657 HGNCID:9495 Length:256 Species:Homo sapiens


Alignment Length:263 Identity:80/263 - (30%)
Similarity:118/263 - (44%) Gaps:35/263 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LCLAVFALLTTAGISHGAPQMGRVVNGTDSSVEKYPFVIS--MRGSSGSHSCGGSIISKQFVMTA 69
            |...:.|||.:     ||.:...:|.|.::.....|::.|  |||:.|||.|||::|...||:||
Human    10 LASVLLALLLS-----GAARAAEIVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTA 69

  Fly    70 AHCTDGRKASDLSVQYGVTKINATGPNVVRVKKIIQHED-----YNPYN--NYANDISLLLVEEP 127
            |||........::|..|...:....|..       ||..     .|.|:  |..||:.|:.:..|
Human    70 AHCLRDIPQRLVNVVLGAHNVRTQEPTQ-------QHFSVAQVFLNNYDAENKLNDVLLIQLSSP 127

  Fly   128 FEFDGVTVAPVKLPELAFATPQTDAGGEGVLIGWGLNATGGYIQSTLQEVELKVYSDEECTERHG 192
            ... ..:||.|:||:.....|.   |.:.:.:|||...........|||:.:.|.: ..|..   
Human   128 ANL-SASVATVQLPQQDQPVPH---GTQCLAMGWGRVGAHDPPAQVLQELNVTVVT-FFCRP--- 184

  Fly   193 GRTDPRYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWI 257
                  ::||..|.....|.|.||||||||.:|...||.|:.|..|....:|..:.:|:.|||||
Human   185 ------HNICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIWGCATRLFPDFFTRVALYVDWI 243

  Fly   258 KKS 260
            :.:
Human   244 RST 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 72/236 (31%)
Tryp_SPc 30..259 CDD:238113 74/237 (31%)
PRTN3NP_002768.3 Tryp_SPc 28..246 CDD:238113 74/238 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.