DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and KLK6

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001012982.1 Gene:KLK6 / 5653 HGNCID:6367 Length:244 Species:Homo sapiens


Alignment Length:261 Identity:79/261 - (30%)
Similarity:121/261 - (46%) Gaps:34/261 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LAVFALLTTAGISHGAPQMGRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAHCT 73
            :.|.:|:..|    .|.:..::|:|.......:|:..::. :||...|||.:|...:|:||||| 
Human     5 MVVLSLIAAA----WAEEQNKLVHGGPCDKTSHPYQAALY-TSGHLLCGGVLIHPLWVLTAAHC- 63

  Fly    74 DGRKASDLSVQYGVTKI-----NATGPNVVRVKKIIQHEDYNPYNNYANDISLLLVEEPFEFDGV 133
               |..:|.|..|...:     :....:|||.   :.|.||:. .::..||.||.:         
Human    64 ---KKPNLQVFLGKHNLRQRESSQEQSSVVRA---VIHPDYDA-ASHDQDIMLLRL--------- 112

  Fly   134 TVAPVKLPELAFATP-QTDAGGEGV---LIGWGLNATGGYIQSTLQEVELKVYSDEECTERHGGR 194
             ..|.||.||....| :.|......   ::|||..|.|.: ..|:|...:.:.|.|||...:.|:
Human   113 -ARPAKLSELIQPLPLERDCSANTTSCHILGWGKTADGDF-PDTIQCAYIHLVSREECEHAYPGQ 175

  Fly   195 TDPRYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIKK 259
            ..... :|.|.::.||..|.|||||||:......|:|||...||.....||||..|.:|.:||:|
Human   176 ITQNM-LCAGDEKYGKDSCQGDSGGPLVCGDHLRGLVSWGNIPCGSKEKPGVYTNVCRYTNWIQK 239

  Fly   260 S 260
            :
Human   240 T 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 72/236 (31%)
Tryp_SPc 30..259 CDD:238113 74/237 (31%)
KLK6NP_001012982.1 Tryp_SPc 23..237 CDD:214473 72/234 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 157 1.000 Inparanoid score I4287
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8476
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.