DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and KLK7

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_005037.1 Gene:KLK7 / 5650 HGNCID:6368 Length:253 Species:Homo sapiens


Alignment Length:261 Identity:72/261 - (27%)
Similarity:126/261 - (48%) Gaps:20/261 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRNQDLCLAVFAL---LTTAGISHGAPQMGRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIIS 62
            |:|:..|.|.:..|   |.|||   ...|..::::|...:...:|:.:::...:..| |||.:::
Human     1 MARSLLLPLQILLLSLALETAG---EEAQGDKIIDGAPCARGSHPWQVALLSGNQLH-CGGVLVN 61

  Fly    63 KQFVMTAAHCTDGRKASDLSVQYGVTKINATGPNVVRVKKIIQHEDYNPYNNYANDISLLLVEEP 127
            :::|:|||||    |.::.:|..|...:.......::..|..:|..|:. ..:.||:.|:.:...
Human    62 ERWVLTAAHC----KMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYST-QTHVNDLMLVKLNSQ 121

  Fly   128 FEFDGVTVAPVKLPELAFATPQTDAGGEGVLIGWGLNATGGY-IQSTLQEVELKVYSDEECTERH 191
            .....: |..|:||... ..|.|..    .:.|||...:... ..|.|..|::|:.|.::||:.:
Human   122 ARLSSM-VKKVRLPSRC-EPPGTTC----TVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVY 180

  Fly   192 GGRTDPRYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDW 256
            ....: ...:|.|:.:..|..|:|||||||:..|...|:|||...||.....||||.:|.::..|
Human   181 KDLLE-NSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKW 244

  Fly   257 I 257
            |
Human   245 I 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 60/228 (26%)
Tryp_SPc 30..259 CDD:238113 62/229 (27%)
KLK7NP_005037.1 Tryp_SPc 29..245 CDD:214473 60/228 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BS0U
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 157 1.000 Inparanoid score I4287
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.