DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and PRSS3

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_011516267.1 Gene:PRSS3 / 5646 HGNCID:9486 Length:333 Species:Homo sapiens


Alignment Length:234 Identity:86/234 - (36%)
Similarity:121/234 - (51%) Gaps:20/234 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAHCTDGRKASDLSVQYGVTKINAT 93
            ::|.|........|:.:|:  :||||.||||:||:|:|::||||...|    :.|:.|...|...
Human   109 KIVGGYTCEENSLPYQVSL--NSGSHFCGGSLISEQWVVSAAHCYKTR----IQVRLGEHNIKVL 167

  Fly    94 GPN--VVRVKKIIQHEDYNPYNNYANDISLLLVEEPFEFDGVTVAPVKLPELAFATPQTDAGGEG 156
            ..|  .:...|||:|..|| .:...|||.|:.:..|...: ..|:.:.||    .||.. ||.|.
Human   168 EGNEQFINAAKIIRHPKYN-RDTLDNDIMLIKLSSPAVIN-ARVSTISLP----TTPPA-AGTEC 225

  Fly   157 VLIGWGLNAT-GGYIQSTLQEVELKVYSDEECTERHGGR-TDPRYHICGGVDEGGKGQCSGDSGG 219
            ::.|||...: |......|:.::..|.:..||...:.|: |:..:  |.|..||||..|..||||
Human   226 LISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMF--CVGFLEGGKDSCQRDSGG 288

  Fly   220 PLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIK 258
            |::.|||..|:|||. ..|.....||||.||..||||||
Human   289 PVVCNGQLQGVVSWG-HGCAWKNRPGVYTKVYNYVDWIK 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 83/231 (36%)
Tryp_SPc 30..259 CDD:238113 86/233 (37%)
PRSS3XP_011516267.1 Tryp_SPc 109..325 CDD:214473 83/231 (36%)
Tryp_SPc 110..328 CDD:238113 86/233 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8476
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.