DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and PRSS2

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001290343.1 Gene:PRSS2 / 5645 HGNCID:9483 Length:261 Species:Homo sapiens


Alignment Length:261 Identity:92/261 - (35%)
Similarity:126/261 - (48%) Gaps:28/261 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLTTAGISHGAP--QMGRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAHCTDGR 76
            :||....:..||  ...::|.|........|:.:|:  :||.|.||||:||:|:|::|.||....
Human     6 ILTFVAAAVAAPFDDDDKIVGGYICEENSVPYQVSL--NSGYHFCGGSLISEQWVVSAGHCYKSA 68

  Fly    77 KASDLS----------VQYGVTKINATGPN--VVRVKKIIQHEDYNPYNNYANDISLLLVEEPFE 129
            ..|.||          |:.|...|.....|  .:...|||:|..||. ....|||.|:.:..|..
Human    69 INSKLSGRGCEYHRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNS-RTLDNDILLIKLSSPAV 132

  Fly   130 FDGVTVAPVKLPELAFATPQTDAGGEGVLIGWGLN-ATGGYIQSTLQEVELKVYSDEECTERHGG 193
            .:. .|:.:.||     |....||.|.::.|||.. ::|......||.::..|.|..||...:.|
Human   133 INS-RVSAISLP-----TAPPAAGTESLISGWGNTLSSGADYPDELQCLDAPVLSQAECEASYPG 191

  Fly   194 R-TDPRYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWI 257
            : |:..:  |.|..||||..|.||||||::.||:..|||||.. .|.....||||.||..|||||
Human   192 KITNNMF--CVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGY-GCAQKNRPGVYTKVYNYVDWI 253

  Fly   258 K 258
            |
Human   254 K 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 85/241 (35%)
Tryp_SPc 30..259 CDD:238113 88/243 (36%)
PRSS2NP_001290343.1 Tryp_SPc 23..253 CDD:214473 85/241 (35%)
Tryp_SPc 24..256 CDD:238113 88/243 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8476
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.