DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and zmp:0000001088

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_688573.1 Gene:zmp:0000001088 / 560086 ZFINID:ZDB-GENE-140106-48 Length:263 Species:Danio rerio


Alignment Length:265 Identity:89/265 - (33%)
Similarity:126/265 - (47%) Gaps:33/265 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LCLAVFALLTTAGISHGAPQMGRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAH 71
            |.|.:..||....:|.......|:|.|...:.....:::|::.::|.|.|||::|:|.:|:||||
Zfish     4 LLLLLCVLLEILAVSCQDVIQARIVGGYVPAPYSIKYIVSIQSATGQHFCGGTLINKYWVLTAAH 68

  Fly    72 CTDGRK-----ASDLSV--QYGVTKINATGPNVVRVKKIIQHEDYNPYNNYANDISLLLVEEPFE 129
            |..|..     |.|.||  ..|:.:..       |...:|.|..|:...|.| ||.|:.::.|..
Zfish    69 CNIGEANMRIVAGDYSVGLYEGMEQFR-------RPHMLIPHPQYDRSTNNA-DIMLIKLQSPVY 125

  Fly   130 FDG-VTVAPVKLPELAFATPQTDA----GGEGVLIGWGLNATGGYIQSTLQEVELKVYSDEEC-- 187
            .:. |::.|:         |:.||    |....:.|||...:.|.|.|.|:.|:|.:.|...|  
Zfish   126 LNSYVSLVPL---------PRQDAMVAVGRLCSVSGWGFTTSTGGISSILRTVKLPIVSTAVCNG 181

  Fly   188 TERHGGRTDPRYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQ 252
            |:...|...... ||.|...|||..|.|||||||:..|:..|||||. ..|..|.|||||..|||
Zfish   182 TDSFNGNITENM-ICAGYSTGGKDACKGDSGGPLVCEGRVYGIVSWG-NGCADAQYPGVYTAVSQ 244

  Fly   253 YVDWI 257
            :..||
Zfish   245 FRQWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 82/241 (34%)
Tryp_SPc 30..259 CDD:238113 83/242 (34%)
zmp:0000001088XP_688573.1 Tryp_SPc 26..249 CDD:214473 82/241 (34%)
Tryp_SPc 27..252 CDD:238113 83/242 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.