DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and LOC560023

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_021325702.1 Gene:LOC560023 / 560023 -ID:- Length:271 Species:Danio rerio


Alignment Length:245 Identity:85/245 - (34%)
Similarity:119/245 - (48%) Gaps:37/245 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RVVNGTDSSVEKYPFVISMRGS---SGSHSCGGSIISKQFVMTAAHCTDGRKAS---------DL 81
            |::.|.    |..|:.|..:.|   ...|.|||::|..|:|:|||||  .|.||         :|
Zfish    43 RIIGGQ----EVVPYSIKYQVSLQVDRKHFCGGTLIQPQWVLTAAHC--WRPASVIQVVLSEHNL 101

  Fly    82 SVQYGVTKINATGPNVVRVKKIIQHEDYNPYNNYANDISLLLVEEPFEFDGVTVAPVKLPELAFA 146
            :|:.|..:       |..|.|:..|..||| ..:.|||.::.:..|.:.:.. |.|..||  ...
Zfish   102 AVEEGFEQ-------VCTVAKVFSHVAYNP-KTFNNDIMIIKLTAPAQINAY-VQPALLP--TAD 155

  Fly   147 TPQTDAGGEGVLIGWGLNAT-GGYIQSTLQEVELKVYSDEECTERHGGRTDPRYHICGGVDEGGK 210
            ||:...|....:.|||:... ..|:...|:.|:::::|  .|...:..|.:... ||.|...|||
Zfish   156 TPELAGGSSCTVSGWGVTRLYNFYLSPILRAVDVEIFS--SCQLYYYYRVNDNM-ICAGSRFGGK 217

  Fly   211 GQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQY---VDWI 257
            ..|.||||||||.:|...|||||.| .|.:..|||||.||..|   :|||
Zfish   218 DSCQGDSGGPLICDGYLEGIVSWGI-GCALPYYPGVYTKVRNYNRWIDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 83/243 (34%)
Tryp_SPc 30..259 CDD:238113 84/244 (34%)
LOC560023XP_021325702.1 Tryp_SPc 43..263 CDD:214473 82/240 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.