DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and KLK15

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_059979.2 Gene:KLK15 / 55554 HGNCID:20453 Length:256 Species:Homo sapiens


Alignment Length:262 Identity:81/262 - (30%)
Similarity:123/262 - (46%) Gaps:31/262 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 FALLTTAGISHGAPQMGRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAHCTDGR 76
            |.|.:||     |....:::.|.:.:....|:.:::. ..|..:||.|:||..:|::||||    
Human     9 FLLASTA-----AQDGDKLLEGDECAPHSQPWQVALY-ERGRFNCGASLISPHWVLSAAHC---- 63

  Fly    77 KASDLSVQYGVTKI-NATGPNVVR-VKKIIQHEDYNPYNNYANDISLLLVEEPFEFDGVTVAPVK 139
            ::..:.|:.|...: ...||..:| ..::|.|..|.. .::.|||.||.:.:|...: ..|.|..
Human    64 QSRFMRVRLGEHNLRKRDGPEQLRTTSRVIPHPRYEA-RSHRNDIMLLRLVQPARLN-PQVRPAV 126

  Fly   140 LPELAFATPQTDAGGEGVLIGWGL-----NATGGYIQS------TLQEVELKVYSDEECTERHGG 193
            ||     |.....|...|:.||||     ..|.|..:|      ||....:.:.||..|.:.:.|
Human   127 LP-----TRCPHPGEACVVSGWGLVSHNEPGTAGSPRSQVSLPDTLHCANISIISDTSCDKSYPG 186

  Fly   194 RTDPRYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIK 258
            |. ....:|.|.:..|...|.|||||||:..|...|||||...||.....||||.||..|::||:
Human   187 RL-TNTMVCAGAEGRGAESCEGDSGGPLVCGGILQGIVSWGDVPCDNTTKPGVYTKVCHYLEWIR 250

  Fly   259 KS 260
            ::
Human   251 ET 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 74/240 (31%)
Tryp_SPc 30..259 CDD:238113 76/241 (32%)
KLK15NP_059979.2 Tryp_SPc 25..249 CDD:214473 74/236 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 157 1.000 Inparanoid score I4287
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8476
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.