DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and Elane

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_056594.2 Gene:Elane / 50701 MGIID:2679229 Length:265 Species:Mus musculus


Alignment Length:263 Identity:73/263 - (27%)
Similarity:119/263 - (45%) Gaps:46/263 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LCLAVFALLTTAGISHGAPQM-GRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAA 70
            :.||:|.         |.|.: ..:|.|..:....:||:.|:: ..|.|.||.::|::.|||:||
Mouse    14 MLLALFL---------GGPALASEIVGGRPARPHAWPFMASLQ-RRGGHFCGATLIARNFVMSAA 68

  Fly    71 HCTDGRKASDLSVQYGVTKI--NATGPNVVRVKKIIQHEDYNPYNNYANDISLLLVEEPFEFDG- 132
            ||.:|.....:.|..|...:  .........|::|.:: .::| :...|||.::      :.:| 
Mouse    69 HCVNGLNFRSVQVVLGAHDLRRQERTRQTFSVQRIFEN-GFDP-SQLLNDIVII------QLNGS 125

  Fly   133 VTV-APVKLPELAFATPQTDAGGEGV-------LIGWGLNATGGYIQSTLQEVELKVYSDEECTE 189
            .|: |.|::.:|       .|.|:||       .:|||...|.....|.|||:.:.|.:: .|..
Mouse   126 ATINANVQVAQL-------PAQGQGVGDRTPCLAMGWGRLGTNRPSPSVLQELNVTVVTN-MCRR 182

  Fly   190 RHGGRTDPRYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYV 254
                    |.::|..|.....|.|.|||||||:.|....||.|:....|....||..:..|:::.
Mouse   183 --------RVNVCTLVPRRQAGICFGDSGGPLVCNNLVQGIDSFIRGGCGSGLYPDAFAPVAEFA 239

  Fly   255 DWI 257
            |||
Mouse   240 DWI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 66/238 (28%)
Tryp_SPc 30..259 CDD:238113 68/239 (28%)
ElaneNP_056594.2 Tryp_SPc 28..242 CDD:214473 66/238 (28%)
Tryp_SPc 29..245 CDD:238113 68/239 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.