DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and Prss33

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001102497.1 Gene:Prss33 / 497873 RGDID:1583742 Length:277 Species:Rattus norvegicus


Alignment Length:275 Identity:86/275 - (31%)
Similarity:130/275 - (47%) Gaps:25/275 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SRNQDLCLAVFALLTTAGISHGAPQM-GRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQF 65
            |..|.|.|.|.........:.|.|:| .|:|.|.|:...::|:..|:: ..|:|.||||:|:.|:
  Rat     5 SHLQILLLVVLGARMQECAACGQPRMSSRIVGGRDAQDGEWPWQTSIQ-HRGAHVCGGSLIAPQW 68

  Fly    66 VMTAAHCTDGR-KASDLSVQYGVTKINATGPN--VVRVKKIIQHEDYNPYNNYANDISLLLVEEP 127
            |:||.||...| ..|:.||..|...::.|..:  :|.|.:::...||:. :....|::||.:..|
  Rat    69 VLTAGHCFSRRVLPSEYSVLLGALSLDVTSSHELLVPVLRVLLPPDYSE-DEARGDLALLQLSHP 132

  Fly   128 FEFDGVTVAPVKLPELAFATPQTDAGGEGVLIGWGLNATGGYIQS--TLQEVELKVYSDEECTE- 189
            ... ...:.||.||......|   .|....:.|||..:.|..:..  .||.|.:.:.....|.. 
  Rat   133 VSL-SARIQPVCLPAPGSHPP---PGSPCWVTGWGSLSPGVPLPKGRPLQGVRVPLLDSRACDRL 193

  Fly   190 RHGGRTDPRY-------HICGGVDEGGKGQCSGDSGGPL--IYNGQ--QVGIVSWSIKPCTVAPY 243
            .|.|...|:.       ::|.|...|.|..|.|||||||  :.:|:  .||:|||. |.|.:...
  Rat   194 YHMGANVPKSERIVLPGNLCAGYRRGHKDACQGDSGGPLTCMESGRWVLVGVVSWG-KGCALPNR 257

  Fly   244 PGVYCKVSQYVDWIK 258
            ||||..|::|..||:
  Rat   258 PGVYTNVAKYSPWIQ 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 76/244 (31%)
Tryp_SPc 30..259 CDD:238113 77/246 (31%)
Prss33NP_001102497.1 Tryp_SPc 33..271 CDD:214473 76/244 (31%)
Tryp_SPc 34..272 CDD:238113 76/244 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.