DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and XB5758585

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001011293.1 Gene:XB5758585 / 496746 XenbaseID:XB-GENE-5758586 Length:248 Species:Xenopus tropicalis


Alignment Length:214 Identity:63/214 - (29%)
Similarity:105/214 - (49%) Gaps:29/214 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 CGGSIISKQFVMTAAHCTDGRK--ASDLSVQYGVTKINATGPNVVRVKKIIQHEDYNPYNNY--- 115
            ||||:||.:::::||.|....|  .:.|. ::.:|:...|       ::.||.|...|:|.|   
 Frog    47 CGGSLISSRWIISAASCNQSPKYLIAHLG-KHDITREEGT-------EQHIQVEKTFPHNRYLGL 103

  Fly   116 --ANDISLLLVEEPFEFDGVTVAPVKLPELAFATPQTDAGGEGVLI---GWG-LNATGGYIQSTL 174
              :|:|.|:.:.||.:|:.. |.|:|   :|.:.|:     ||.:.   |:| ||:........|
 Frog   104 SDSNNIMLVKLAEPAQFNQF-VQPIK---VASSCPR-----EGKVCQVSGFGNLNSYAEKYPDRL 159

  Fly   175 QEVELKVYSDEECTERHGGRTDPRYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCT 239
            |.::|.:..:..|......:......:|.|..:..|..|.||:|||||..|:..||:.|. ..|:
 Frog   160 QCLDLPILPESSCDAYFSPKKMHTNLMCAGFAQDDKDSCQGDAGGPLICKGELYGIILWG-NECS 223

  Fly   240 VAPYPGVYCKVSQYVDWIK 258
            ....||||.||..:.:|::
 Frog   224 GRGIPGVYLKVCNFTNWMQ 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 62/211 (29%)
Tryp_SPc 30..259 CDD:238113 63/214 (29%)
XB5758585NP_001011293.1 Tryp_SPc 21..240 CDD:214473 62/210 (30%)
Tryp_SPc 22..244 CDD:238113 63/214 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.