DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and LOC496633

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001011204.1 Gene:LOC496633 / 496633 -ID:- Length:249 Species:Xenopus tropicalis


Alignment Length:252 Identity:75/252 - (29%)
Similarity:126/252 - (50%) Gaps:21/252 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLTTAGISHGAP-QMGRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAHCTDGRK 77
            :|....::..|| ...::|.|.:.:....|:.:... ......||||:::.:::::||||.  |.
 Frog     6 ILLFLAVAAAAPLDDDKIVGGYECTPHSQPWQVYFT-QENQVFCGGSLVTPRWIISAAHCY--RT 67

  Fly    78 ASDLSVQYG---VTKINATGPNVVRVKKIIQHEDYNPYNNYANDISLLLVEEPFEFDGVTVAPVK 139
            ...|....|   :||...|..: ::|:.|.:|..|.. |:..:||.|:.:.:|.:::.. |.|: 
 Frog    68 PKTLVAHLGDHDLTKEEGTEQH-IQVENIYKHFSYKD-NDVDHDIMLVKLAKPAQYNQY-VQPI- 128

  Fly   140 LPELAFATPQTDAGGEGVLIGWGLNATG--GYIQSTLQEVELKVYSDEECTERHGGR-TDPRYHI 201
              .:|.:.|:  .|.|.::.|:|...:.  |.....||.|::.|.||..|...:.|. |:..:  
 Frog   129 --PVARSCPR--EGTECLVSGYGNMRSDNIGEFPDRLQCVDVPVLSDSSCKASYRGLFTENMF-- 187

  Fly   202 CGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIK 258
            |.|..||||..|..||||||:.||:..|:|||. :.|.....||||.||..|:.|::
 Frog   188 CAGFLEGGKDSCQVDSGGPLVCNGELYGVVSWG-QGCAERNAPGVYAKVCNYLGWVQ 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 71/233 (30%)
Tryp_SPc 30..259 CDD:238113 72/235 (31%)
LOC496633NP_001011204.1 Tryp_SPc 23..245 CDD:238113 72/235 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.