DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and CG34130

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001036759.1 Gene:CG34130 / 4379866 FlyBaseID:FBgn0083966 Length:297 Species:Drosophila melanogaster


Alignment Length:288 Identity:55/288 - (19%)
Similarity:107/288 - (37%) Gaps:67/288 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 AVFALLTTAGIS------------HGAPQMGRVVNGTDSSVEKYPFVISMRGSSGSHS------- 55
            ::..|||..|.:            ||.|.: |.:|..           .:|.:||.|:       
  Fly     9 SIALLLTEVGAAHSSWWNSSASYLHGRPPV-RTLNKN-----------GIRRTSGGHAVPWLLRI 61

  Fly    56 -------CGGSIISKQFVMTAAHCTDGRKASDLSVQYGVTKINATGPNVVRVKKIIQHEDYNPYN 113
                   ||.|.:|..:.:|:|:|....::...|:...:...::...|        |.:.::|.|
  Fly    62 VDGPTFVCGASYLSALYALTSANCMHSHRSQMESLSVELVSSDSRQDN--------QLDSHDPPN 118

  Fly   114 NYANDISLLLVEEPFEFDG--VTVAPVKLPE---------LAFATPQTDAGGEGVLIGWGLNATG 167
            ....:|   :|.:.:.:.|  :.||.::|..         :...|....:.....::.:|    .
  Fly   119 ALIRNI---IVSKDWHWPGTFMDVAVIELTNRLRGNRNNYVTLCTNPLSSYKSLSVVSYG----A 176

  Fly   168 GYIQSTLQEVELKVYSDEECTERHGGRTDPRYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVS 232
            |..::...| |::|.:...|...:|... .|..:....:......|...:|.|:....|..|||:
  Fly   177 GPAENVRTE-EIEVLNRMICDSAYGNFL-LRETVACAKEFKRSADCMFSAGCPVTAGDQLCGIVA 239

  Fly   233 WSIKPCTVAPYPGVYCKVSQYVDWIKKS 260
            || ..|..:..||::..:.|...:|.|:
  Fly   240 WS-PACKRSNLPGIFTDIHQVKRFILKA 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 46/252 (18%)
Tryp_SPc 30..259 CDD:238113 46/253 (18%)
CG34130NP_001036759.1 Trypsin 53..263 CDD:278516 41/227 (18%)
Tryp_SPc 53..256 CDD:304450 40/220 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.