DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and Gm5771

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001034086.1 Gene:Gm5771 / 436523 MGIID:3646222 Length:245 Species:Mus musculus


Alignment Length:233 Identity:82/233 - (35%)
Similarity:118/233 - (50%) Gaps:18/233 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAHCTDGRKASDLSVQYGVTKINAT 93
            ::|.|........|:.:|:  :||.|.||||:|:.|:|::||||...|    :.|:.|...|...
Mouse    22 KIVGGYTCRENSVPYQVSL--NSGYHFCGGSLINDQWVVSAAHCYKTR----IQVRLGEHNIKVL 80

  Fly    94 GPN--VVRVKKIIQHEDYNPYNNYANDISLLLVEEPFEFDGVTVAPVKLPELAFATPQTDAGGEG 156
            ..|  .|...|||:|.::| .....|||.|:.:..|...: ..||.|.||...     ..||.:.
Mouse    81 EGNEQFVNAAKIIKHPNFN-RKTLNNDIMLIKLSSPVTLN-ARVATVALPSSC-----APAGTQC 138

  Fly   157 VLIGWGLNATGGYIQ-STLQEVELKVYSDEECTERHGGRTDPRYHICGGVDEGGKGQCSGDSGGP 220
            ::.|||...:.|..: ..||.::..:....:|...:.|:..... :|.|..||||..|.||||||
Mouse   139 LISGWGNTLSFGVSEPDLLQCLDAPLLPQADCEASYPGKITGNM-VCAGFLEGGKDSCQGDSGGP 202

  Fly   221 LIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIK 258
            ::.||:..|||||.. .|.:|..||||.||..|||||:
Mouse   203 VVCNGELQGIVSWGY-GCALADNPGVYTKVCNYVDWIQ 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 80/230 (35%)
Tryp_SPc 30..259 CDD:238113 82/232 (35%)
Gm5771NP_001034086.1 Tryp_SPc 22..238 CDD:214473 80/230 (35%)
Tryp_SPc 23..241 CDD:238113 82/232 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.