DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and Jon99Ciii

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001287598.1 Gene:Jon99Ciii / 43543 FlyBaseID:FBgn0003357 Length:265 Species:Drosophila melanogaster


Alignment Length:272 Identity:93/272 - (34%)
Similarity:132/272 - (48%) Gaps:38/272 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LAVF-ALLTTAGISHGAPQ-----------MGRVVNGTDSSVEKYPFVISMRGS-SGSHSCGGSI 60
            |.|| ||...|..:..||.           .||:.||..:...|.|:::.:..| :|:..|||||
  Fly     3 LFVFLALAVAAATAVPAPAQKLTPTPIKDIQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSI 67

  Fly    61 ISKQFVMTAAHCTDGRKASDLSVQYGVTKINATGPNV---VRVKKIIQHEDYNPYNNYANDISLL 122
            |...:|:||||||:|  ||.:::.||.:  ..|.|..   |....||||..||. .|..||||  
  Fly    68 IGNTWVLTAAHCTNG--ASGVTINYGAS--IRTQPQYTHWVGSGDIIQHHHYNS-GNLHNDIS-- 125

  Fly   123 LVEEPFEFDGVTVAPVKLPELAFATPQTD-AGGEGVLIGWGLNATGGYIQSTLQEVELKVYSDEE 186
            |:..|.......|..|:||  ::.....| ||...|..|||....|..:...||.|::::.|..:
  Fly   126 LIRTPHVDFWSLVNKVELP--SYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQSVDVQIISQSD 188

  Fly   187 CTER---HGGRTDPRYHICGGVDEGGKGQCSGDSGGPLI-YNGQQ-VGIVSWSIKPCTVAPYPGV 246
            |:..   |...      ||...| |||..|.|||||||: ::|.: ||:.|:.......:..|.|
  Fly   189 CSRTWSLHDNM------ICINTD-GGKSTCGGDSGGPLVTHDGNRLVGVTSFGSAAGCQSGAPAV 246

  Fly   247 YCKVSQYVDWIK 258
            :.:|:.|:|||:
  Fly   247 FSRVTGYLDWIR 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 82/237 (35%)
Tryp_SPc 30..259 CDD:238113 83/239 (35%)
Jon99CiiiNP_001287598.1 Tryp_SPc 36..260 CDD:238113 83/239 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.