DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and intr

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_651633.1 Gene:intr / 43397 FlyBaseID:FBgn0039599 Length:298 Species:Drosophila melanogaster


Alignment Length:174 Identity:38/174 - (21%)
Similarity:58/174 - (33%) Gaps:73/174 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SHGAP-QMGRVVNGTDSSVEKYPF----VISMRGSSGSHS------------------------- 55
            |:|.| |:.||:    ..:..||:    .||.|.|||.:.                         
  Fly    34 SNGQPYQIVRVI----EYIVPYPYQRSPKISARFSSGGNKEPNSLEIIPAEIETLLTDGQATTEA 94

  Fly    56 ------------------CGGSIISKQFVMTAAHCTDGRKASDLSVQYGVTKINATGPNVVRVKK 102
                              |.|::||.:.|:|:|.|............|   |:.|:...:..|..
  Fly    95 PKAVKHFVMRILYENKVICSGALISTRLVLTSALCFPRTLRQPPPRSY---KLQASRSRIYSVAN 156

  Fly   103 IIQHEDYNPYNNYANDISLLL----VEEPFEFDGVTVAPVKLPE 142
            :|        .....|::|||    :|:||      |.|:.|.|
  Fly   157 LI--------TGAIEDMALLLLHAPLEDPF------VHPIDLCE 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 34/165 (21%)
Tryp_SPc 30..259 CDD:238113 33/164 (20%)
intrNP_651633.1 Tryp_SPc 112..284 CDD:304450 24/92 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.