DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and CG17475

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:244 Identity:85/244 - (34%)
Similarity:122/244 - (50%) Gaps:22/244 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SHGAPQMGRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAHCTDGRKASDLSVQY 85
            :.|.....||:||.|..:.:..:.||::|..|.|.|||.||.::.|:|||||..|...:.|.|..
  Fly    41 AEGVNFQNRVINGEDVQLGEAKYQISLQGMYGGHICGGCIIDERHVLTAAHCVYGYNPTYLRVIT 105

  Fly    86 GVTKINATGPNVVR-VKKIIQHEDYNPYNNYANDISLLLVEEPFEFDGVTVAPVKLPELAFATPQ 149
            |..:...  |:.|. |::...|.:||. .:|.|||:|:.:.:..:|:..| .|.:||....|.  
  Fly   106 GTVEYEK--PDAVYFVEEHWIHCNYNS-PDYHNDIALIRLNDTIKFNEYT-QPAELPTAPVAN-- 164

  Fly   150 TDAGGEGVLIGWGLNATGGYIQSTLQEVELK--VYSDEECTERHGGRTDPR---YHICGGVDEGG 209
               |.:.:|.|||.....|.....||:..|.  |||  .|.|..  ..||.   .||| .:..||
  Fly   165 ---GTQLLLTGWGSTELWGDTPDILQKAYLTHVVYS--TCQEIM--NNDPSNGPCHIC-TLTTGG 221

  Fly   210 KGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIK 258
            :|.|.|||||||.:||...|:|:|.. ||.:. .|..:..|..|::||:
  Fly   222 QGACHGDSGGPLTHNGVLYGLVNWGY-PCALG-VPDSHANVYYYLEWIR 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 82/233 (35%)
Tryp_SPc 30..259 CDD:238113 83/235 (35%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 82/233 (35%)
Tryp_SPc 50..269 CDD:238113 83/235 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.