DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and CG10405

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster


Alignment Length:281 Identity:83/281 - (29%)
Similarity:134/281 - (47%) Gaps:51/281 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CLAVFALLTTAGI---------SHGAPQM--GRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSII 61
            |.|....|..|||         ....|:.  .|:|||.:::..::|:.:|:|..: .|.||.||:
  Fly     4 CRAPIPFLLIAGILVILEASRTEAAVPRQPDSRIVNGREATEGQFPYQLSLRRQT-VHICGASIL 67

  Fly    62 SKQFVMTAAHCTDG--RKASDLSVQYGVTKINATGPNVVRVKKIIQHEDYNPYN-NYANDISLLL 123
            |..:.:|||||.||  ::..:.:::.| :.:..:|..|..||.|.:|..|:..: |:  |::||.
  Fly    68 SSNWAITAAHCIDGHEQQPREFTLRQG-SIMRTSGGTVQPVKAIYKHPAYDRADMNF--DVALLR 129

  Fly   124 VEEPFEFDGV------TVAPVKLPELAFATPQTDAGGEGVLIGWG-LNATGGYIQSTLQEVELKV 181
            ..     ||.      .|||::||.:..|..::   ...|:.||| ::.:...:.|.|:...:..
  Fly   130 TA-----DGALSLPLGKVAPIRLPTVGEAISES---MPAVVSGWGHMSTSNPVLSSVLKSTTVLT 186

  Fly   182 YSDEECTERHGGRTDPRYHICGGVDEG-------GKGQCSGDSGGPLIYNGQQVGIVSWSIKPCT 239
            .:.|:|      ..|.|:|  |||.|.       ....|.||||||:...|..:|||||.: .|.
  Fly   187 VNQEKC------HNDLRHH--GGVTEAMFCAAARNTDACQGDSGGPISAQGTLIGIVSWGV-GCA 242

  Fly   240 VAPYPGVYCKVSQYV--DWIK 258
            ...|||||.:::...  .||:
  Fly   243 DPYYPGVYTRLAHPTIRRWIR 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 74/246 (30%)
Tryp_SPc 30..259 CDD:238113 75/248 (30%)
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 74/246 (30%)
Tryp_SPc 37..263 CDD:238113 74/246 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.