DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and CG10041

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_650177.2 Gene:CG10041 / 41496 FlyBaseID:FBgn0038014 Length:287 Species:Drosophila melanogaster


Alignment Length:283 Identity:80/283 - (28%)
Similarity:129/283 - (45%) Gaps:39/283 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QDLC-LAVFALLTTAGIS------HGAPQMGRVVNGTD--SSVEKYPFVISM-RGSSG--SHSCG 57
            |.|| :|.||.::.|..:      :..|.:...|:.|.  |...:||:::|: ....|  .|.|.
  Fly     5 QSLCSIAWFAAMSAAQETLSDTPQNSTPLLATTVSTTKVISFRPRYPYIVSIGENLKGYYKHLCV 69

  Fly    58 GSIISKQFVMTAAHCTDGRKASDLSVQYGVTKINATGPNVVRVKKIIQHEDYNPYNNYANDISLL 122
            |.|:|.:||::||||........|.|..|...:|:.......|.:...|..:....  .|||::|
  Fly    70 GVILSNEFVLSAAHCIQTNPTKQLYVAGGADSLNSRKQTRFFVVERRWHPQFRVLG--GNDIAVL 132

  Fly   123 LVEEPFEFDGVTVAPVKLPELAFA-TPQTDAGGEGVLIGWGLNATGGYIQSTLQEVELKVYSDEE 186
            .:...|..|     .|:...:.|| .||.|:|.:..|:|||....|..  ..|||:......::|
  Fly   133 RIYPKFPLD-----DVRFRSINFAGKPQRDSGTQASLVGWGRVGVGKI--RKLQEMPFLTMENDE 190

  Fly   187 CTERHGGRTDPRY------HICGGVDEGGKGQCSGDSGGPLIYNGQQ--VGIVSWSIKPCT-VAP 242
            |.:.|      |:      .||....:|.:|.|.||||.||:...::  .|::|:..|.|| :.|
  Fly   191 CQQSH------RFVFLKPLDICAMHLKGPRGPCDGDSGAPLMNVAKEKLYGLLSYGRKACTPLKP 249

  Fly   243 YPGVYCKVSQYVDWIKKSQIILA 265
            |  .:.:::.|..||::|...:|
  Fly   250 Y--AFTRINAYSSWIQESMDSMA 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 68/242 (28%)
Tryp_SPc 30..259 CDD:238113 70/243 (29%)
CG10041NP_650177.2 Tryp_SPc 49..264 CDD:238113 67/231 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447011
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.