DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and CG12951

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster


Alignment Length:265 Identity:201/265 - (75%)
Similarity:224/265 - (84%) Gaps:0/265 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRNQDLCLAVFALLTTAGISHGAPQMGRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQF 65
            |..||||.|::..:|....:...||.:.||||||||||.|||||:|:|...||||||||||||.|
  Fly     1 MLSNQDLSLSLIVILAVTTVGQAAPSISRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHF 65

  Fly    66 VMTAAHCTDGRKASDLSVQYGVTKINATGPNVVRVKKIIQHEDYNPYNNYANDISLLLVEEPFEF 130
            ||||||||:||.|..||:|:|||.|:|.|||||.:||||||||::|....|||||||:|||||||
  Fly    66 VMTAAHCTNGRPADTLSIQFGVTNISAMGPNVVGIKKIIQHEDFDPTRQNANDISLLMVEEPFEF 130

  Fly   131 DGVTVAPVKLPELAFATPQTDAGGEGVLIGWGLNATGGYIQSTLQEVELKVYSDEECTERHGGRT 195
            |||:||||:||.||||.||:|||.||||||||||.|.|.:|.|||||.||:|||||||.||.|:|
  Fly   131 DGVSVAPVELPALAFAVPQSDAGVEGVLIGWGLNDTYGSVQDTLQEVSLKIYSDEECTSRHNGQT 195

  Fly   196 DPRYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIKKS 260
            ||:||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||.:
  Fly   196 DPKYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIKSN 260

  Fly   261 QIILA 265
            |||.|
  Fly   261 QIISA 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 185/227 (81%)
Tryp_SPc 30..259 CDD:238113 186/228 (82%)
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 185/227 (81%)
Tryp_SPc 30..260 CDD:238113 187/229 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447010
Domainoid 1 1.000 222 1.000 Domainoid score I5640
eggNOG 1 0.900 - - E33208_3BS0U
Homologene 1 1.000 - - H89214
Inparanoid 1 1.050 228 1.000 Inparanoid score I5860
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27286
OrthoDB 1 1.010 - - D61497at7147
OrthoFinder 1 1.000 - - FOG0012685
OrthoInspector 1 1.000 - - otm42512
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
1211.910

Return to query results.
Submit another query.