DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and Tmprss11c

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001003979.1 Gene:Tmprss11c / 408213 RGDID:1302967 Length:418 Species:Rattus norvegicus


Alignment Length:238 Identity:75/238 - (31%)
Similarity:119/238 - (50%) Gaps:20/238 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAHC-TDGRKASDLSVQYGVTKINA 92
            :|..|.|:...::|:..|:: .:..|.||.::||..:::||||| .......|..|.:|..   .
  Rat   186 KVAGGQDAEEGEWPWQASLQ-QNNVHRCGATLISNSWLITAAHCFVRSANPKDWKVSFGFL---L 246

  Fly    93 TGPNVVR-VKKIIQHEDYNPYNNYANDISLLLVEEPFEFDGVTVAPVKLPELAFATPQTDAGGEG 156
            :.|...| ||.|:.||:|: |..:.|||:::.:..|..::. .:....|||   ||.:.....:.
  Rat   247 SKPQAQRAVKSIVIHENYS-YPAHNNDIAVVRLSSPVLYEN-NIRRACLPE---ATQKFPPNSDV 306

  Fly   157 VLIGWGLNATGGYIQSTLQEVELKVYSDEECT--ERHGGRTDPRYHICGGVDEGGKGQCSGDSGG 219
            |:.|||...:.|...:.||:..:|:..::.|.  :.:||...|.. :|.|..||....|.|||||
  Rat   307 VVTGWGTLKSDGDSPNILQKGRVKIIDNKTCNSGKAYGGVITPGM-LCAGFLEGRVDACQGDSGG 370

  Fly   220 PLIYNGQQ-----VGIVSWSIKPCTVAPYPGVYCKVSQYVDWI 257
            ||:....:     .|||||. ..|.:...||||.:|:.|.|||
  Rat   371 PLVSEDSKGIWFLAGIVSWG-DECALPNKPGVYTRVTHYRDWI 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 73/236 (31%)
Tryp_SPc 30..259 CDD:238113 75/237 (32%)
Tmprss11cNP_001003979.1 SEA 62..157 CDD:279699
Tryp_SPc 186..412 CDD:214473 73/236 (31%)
Tryp_SPc 187..415 CDD:238113 75/237 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.