DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and Klk4

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001004101.1 Gene:Klk4 / 408210 RGDID:1303228 Length:256 Species:Rattus norvegicus


Alignment Length:254 Identity:72/254 - (28%)
Similarity:113/254 - (44%) Gaps:27/254 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 FALLTTAGISHGAPQMGRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAHCTDGR 76
            :.:|...| |..:....|::.|.|......|:..::.....:..|.|.::..|:|::||||..  
  Rat    15 YLILEVTG-SSASSISSRIIQGQDCLPHSQPWQAALFSEDNAFFCSGVLVHPQWVLSAAHCIQ-- 76

  Fly    77 KASDLSVQYGVTKINAT---GPNVVRVKKIIQHEDYNPYNNYANDISLL-LVEEPFEFDGVTVAP 137
              ...:|..|:..:..:   |..::.....|||.:||. .::|||:.|: |.|...|.:.:...|
  Rat    77 --DSYTVGLGLHNLEGSQEPGSRMLEAHLSIQHPNYND-PSFANDLMLIKLNESVMESNTIRRIP 138

  Fly   138 VKLPELAFATPQTDAGGEGVLI-GWGLNATGGYIQSTLQEVELKVYSDEECTERHGGRTDPRYHI 201
            |        ..|....|:..|: ||| ....|.:.|.||.|.|.|.|:|.|...:    ||.||:
  Rat   139 V--------ASQCPTPGDTCLVSGWG-RLKNGKLPSLLQCVNLSVASEETCRLLY----DPVYHL 190

  Fly   202 ---CGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWI 257
               |.|.....|..|:||||||::.|....|:||.....|.....|.||..:.::.:||
  Rat   191 SMFCAGGGPDRKDTCNGDSGGPIVCNRSLQGLVSMGQGECGQPGIPSVYTNLCKFTNWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 67/235 (29%)
Tryp_SPc 30..259 CDD:238113 68/236 (29%)
Klk4NP_001004101.1 Tryp_SPc 35..249 CDD:238113 66/231 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.