DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and CG14642

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster


Alignment Length:263 Identity:78/263 - (29%)
Similarity:124/263 - (47%) Gaps:53/263 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GRVVNGTDSSVEKYPFVISM-----RGSSGSHSCGGSIISKQFVMTAAHCTDGRKASDLSVQYG- 86
            |||:    :...:||.:.::     ||.. .:.||||:||::||:||||||...:|....|:.| 
  Fly   146 GRVL----ARPGEYPHMAAVGFESDRGQV-DYKCGGSLISERFVLTAAHCTSIYEAPPKWVRIGD 205

  Fly    87 ---VTKINATGPNVVRVKKIIQHEDYNPYNNYANDISLLLVEEPFEFDGVTVAPVKL---PELAF 145
               .::..:....::|::::..|.:|.. ..|.:||:||.:|:..|.... |.||:|   |||  
  Fly   206 LDLASEKRSVEAQLLRIEQVFAHPNYKK-KMYYDDIALLKLEKEVELTEY-VRPVRLWVFPEL-- 266

  Fly   146 ATPQTDAGGEGVLIGWGLNATGGYIQSTLQEVELKVYSDEECTERHGGRTDPRYHICGGVDEG-- 208
              |.|.|    ..:|:|..:....:.:.|..:.|.|..:.||    .....|......||.|.  
  Fly   267 --PTTIA----FAMGYGATSFAKPMTNRLTNLNLTVVPNAEC----NAELPPLAETPSGVLESQI 321

  Fly   209 -------GKGQCSGDSGGPLIYN--GQQ---------VGIVSWSIKPCTVAPYPGVYCKVSQYVD 255
                   .:..|.|||||||..|  |::         :||.|:.:. |. :.||.||.:||.::|
  Fly   322 CAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVF-CR-SSYPSVYTRVSSFLD 384

  Fly   256 WIK 258
            ||:
  Fly   385 WIE 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 75/259 (29%)
Tryp_SPc 30..259 CDD:238113 76/261 (29%)
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 77/261 (30%)
Tryp_SPc 146..386 CDD:214473 76/260 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456077
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.