DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and CG11037

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_649272.1 Gene:CG11037 / 40317 FlyBaseID:FBgn0037038 Length:292 Species:Drosophila melanogaster


Alignment Length:244 Identity:73/244 - (29%)
Similarity:117/244 - (47%) Gaps:22/244 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 APQMGRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAHCTDGR-KASDLSVQYGV 87
            :|...||:.|..::..|....::.........|||:::::..|:|||||..|| |||:..|..|:
  Fly    56 SPHETRVIGGHVTTNAKLGGYLTALLYEDDFVCGGTLLNENIVLTAAHCFLGRMKASEWIVAAGI 120

  Fly    88 TKINATGPNVVR--VKKIIQHEDYNPYNNYANDISLLLVEEPFEFDGVTVAPVKLPELAFATPQT 150
            :.:|..|   :|  ||..|..|.:.. ::...|::::|::.|.:...:..       |:..:...
  Fly   121 SNLNQKG---IRRHVKDFILSEQFRE-DDMNMDVAVVLLKTPLKAKNIGT-------LSLCSVSL 174

  Fly   151 DAGGEGVLIGWGLNATGGY-IQSTLQEVELKVYSDEECTERH---GGRTDPRYHICGGVDEGGKG 211
            ..|.|.|:.|||:.|..|. ..:.|:.|.:.:...:.|...:   ...||..  ||..| .|.|.
  Fly   175 KPGVELVVSGWGMTAPRGRGPHNLLRTVTVPIIHKKNCRAAYQPTAKITDSM--ICAAV-LGRKD 236

  Fly   212 QCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIKKS 260
            .|:.||||||::..|..||||:.| .|....|||||..|.....:|:||
  Fly   237 ACTFDSGGPLVFKKQVCGIVSFGI-GCASNRYPGVYTDVMYVKPFIEKS 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 69/234 (29%)
Tryp_SPc 30..259 CDD:238113 69/235 (29%)
CG11037NP_649272.1 Tryp_SPc 61..281 CDD:214473 69/234 (29%)
Tryp_SPc 62..283 CDD:238113 69/235 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.